lighttpd-1.4.55-lp151.3.6.1<>,l8^|ɸ/=„#\0ne3 yF_aMƬ(չL5N#Q=\ڀ5GtK;AE PH c&sBg>C.Y^:#GVR<7ӈ{e@f' >X>I?d   V - Fj AFj8j  j j j .j /$j0j2j5x5j7D7-8<-;-(;_8;h%9;%:?'%=>?@FGjHҨjIPjXԼY\ j]ִj^,bݠcIdeflujv,wjxXjyz,<@_hpvClighttpd1.4.55lp151.3.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^|obs-arm-5PopenSUSE Leap 15.1openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxarmv7hl/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}%Ft%WT7FW Gg|%& V6|%&V%&D&d&x&D&(&wh%Vx%&T&@%fO`@z 5_.JzL &P K~.VQ Np&nAA聠A聠A큤A큤AAAAA^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^|^|^|^|^|^|^|^|f45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859d109caf15c159fbbd797a52d7d71f79a43b94c4a5f830d53eb8303177be80f4b1df39596e88d7e32c3458571f022c4a5564a9d090a2b031421237df9347769725da53eace3b726431afdca1eb13a2e9f4d9f1672bf2983386f8330b414035b83149fb67059fee3eebdc5b0069b515e225b7a35d4a8f9259f8546420cbd432a96f90988a6994ceca922990abcdbba911aed60fda19a28d5aa1c5ee4f54c1abcce53bf717c1a8da586aeea73abd65f50a211f65b230a03c2e5ba86eeff7e890c440f0970bb48bb3ae3fe911932106e0f6c74c920cd87a9e8021f0c2de4dca8de5bfdd21408f93fc4c6e8020232b3df872322541c3081e6ba4cc6bd34448d6f3bc1686d6a2b52c5d86b899f5be7e0b93807ecd6a9fba8208bb0ee5dff546a983db93754f339fb8ce4527438da21cb4811dbd00ea4bfbe0627385236a833de0127ec1eada4d1a56431d1a234cd5ce390030811d66e113d6a0a002817b45e0ae3051837651383f57d07dcaed6ec50da5f15ecef82d6a606616f2b320cd11d9a493317ee696e53b2fa3a8f76a6ee620a5d3236a7da1a96453fdc40a832219871d4daf8ff0ac5d1b0cd182d3666853eae85318aa3de0a2fb140b6fdfb235748836c67715419d070842ca2bb1ddfa84f7ce3d80a390c2b3bcbb4fd585c5e29e19fef66bc3f553f0d7222c19452a87c22db4a104bb4c79ec0e9d5d09aca233b2376727cff28775789025fea02aacd3f2d2f97255a334d4a91627ba984a1602c67fd0a48a545ef17c22c0872e2656a14448092abadf1cddc562a57705d3c75c56c5b1b6172e79aecfae4cc36b077a0d0407daef37b758120a30e1bbb9e5ae79b669123f19c6bc657e6c6ca0e5cd196c40144e5e81a31db3e21fa4fa988e20ef59663beb3c9aec6bc47b6f6a44d1a1cd9e8eb196de2e0217b3c61da0a90f5c3e69122fd24cf89f5b1351cc5a31a64d91c266069ea5f9561ad203746caff554847bb48df52fbbe8138463df5d085332ac39e1bbca353a5f894ecc0cd80e9d1967e34326f5328a3f8fc447c26b5edb1cf06b9fe34a990d767cbf884bae81c3ab2a192e9e5f68ea542aad4512a8f174370103ac0fd426140de7bbdabd97177133375f7cee2ce48df79511e53626867a39470adce7e018410923710c45a4ff880d05bd84bd1b75a7c270941c6b82980ab90b82ece665a5628bf9ad94e2ab62f753d6cc8c6edb365ce60c6085a5c4528bfe35398736a8994aedb1636e10643a20f4c96afb05994930b51b91bd66000fb49285e0be2af195876afeeef282c3dc3b26c2e9eb2d30ab19d720c0d15aacbe60e5f84886cb4c97817b98904c9a6eba47138ffc5424f8d339dae200c3b4fb805abab1de0837f0424539d5164edce26bd28d21b5d8e71d3778e3ae5813d7eb30bf5a170d07c1d1e8ad674175a4f78a0c1644858c28c48b15cc8e63d2b2d711ff5897071b0c444a23f2c696bb4633385d7888b8a95939ac95c3f064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456dc4577fb0ef922f1a19bc93d79a725ac476e4aeb158c33682b5b301e20338d9861592f9a825cd068d38c9bfad2222cda0f1c18c35b381cfef2cbf23ddba5bd083762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-lp151.3.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(armv7hl-32) @@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgrepld-linux-armhf.so.3ld-linux-armhf.so.3(GLIBC_2.4)libattr.so.1libattr.so.1(ATTR_1.0)libbz2.so.1libc.so.6libc.so.6(GLIBC_2.10)libc.so.6(GLIBC_2.15)libc.so.6(GLIBC_2.17)libc.so.6(GLIBC_2.25)libc.so.6(GLIBC_2.4)libc.so.6(GLIBC_2.9)libcrypt.so.1libcrypt.so.1(GLIBC_2.4)libcrypto.so.1.1libcrypto.so.1.1(OPENSSL_1_1_0)libdl.so.2libdl.so.2(GLIBC_2.4)libev.so.4libfam.so.0libgcc_s.so.1libgcc_s.so.1(GCC_3.5)libpcre.so.1libssl.so.1.1libssl.so.1.1(OPENSSL_1_1_0)libz.so.1rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-lp151.3.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shobs-arm-5 1585220041  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-lp151.3.6.11.4.55-lp151.3.6.11.4.55-lp151.3.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpd.servicelighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib//usr/lib/lighttpd//usr/lib/systemd/system//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:12187/openSUSE_Leap_15.1_Update_ports/eaa90769400a9aeb91e18cd49f842a90-lighttpd.openSUSE_Leap_15.1_Updatedrpmxz5armv7hl-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=58cebfad12afadd7d3c9b26d2506a1f6d52c15e8, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=3f2b7c3ea7ff7d5fd281a87dd29878e8f4b64336, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=d8deb2f0cb36ed9da85eccff705097fcca478f95, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=f49a50111be27d74b1f22d6105216eb3b2238f16, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=aea1b63ceb54b1b8a514fffa0ee7fa7e6c1f8a0c, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=c902e6b123c031f7ff5f41985caa34c69b1ff0e0, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=408fb5c36321f5610f8e1a58348e0ee6674a48d8, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=159fac3f8f309b3b1b3f3f4d74f094da7efb49e6, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=4fcd36423f95c3b6af2b5bd571d597cd79d0077a, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=a505338e866d6c668e2b666a77c95b2155c07cca, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=0e9a996cd621b0d8e2fe4543cf9d315b8466dc61, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=942cf8d242df14f1363f84fefb514bab7285a115, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=3f5595bfff7390eb54dbae47ea0419fe26e4943d, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=ab0d246f072cf7a1fed337905737c3797e740545, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=cdcf9b112a19d141f1885a29aae9ac896f2f2118, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=5f6f1addf15a3bd822dd849fd282a585a5ec3d3c, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=af93cab8a83023ffb5cd85e03a98b8b67e34da71, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=774a80e6e9d930bb5f2f0ff25cdb5c91e23bf22b, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=d7300986ef0df254185015f3ec148f5ece753070, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=d9a7808c7fe6d7ad96ace5b267d6867159b6a140, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=6bbeb213ceab29860310fae1697113bdc6613109, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=a305a72fdd8f3e098da0c0097eacf00affd39348, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=14f8ea1d1ca24f68287f8399b370edcf4041a318, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=ce3cf9ba5550acc5bb4960608c0891cf46e09b4e, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=73311de341c2cf1babe224e55b99a5fda1f84b6e, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=7723ad790166af57abde998d20a99e66648c2b10, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=7930f631a7092bf8932f6398125c86f6f6dad1cc, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=19a43a9d2326af6f42136eff0198fc80b7aec511, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=87623ee91500ac50824ab081f053566bfaab9a8c, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=5857c866e62b70270231a832abf167fa76fa263c, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=113bb07719ab0c3e060fcf2e2af436ba2ad03148, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=de8e0e5dfe2a2d5375af623fd81434e634029635, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, BuildID[sha1]=1d8169869529513486902984eeccda898ac11d8a, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, interpreter /lib, BuildID[sha1]=63d804acb4480c453b628b48ebb0ef772ceb86fd, for GNU/Linux 3.2.0, strippedELF 32-bit LSB shared object, ARM, EABI5 version 1 (SYSV), dynamically linked, interpreter /lib, BuildID[sha1]=e3b4d942fae5b3cc64ff882933dea97f91392ecb, for GNU/Linux 3.2.0, strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) #+3:>BFLRVZdjnrv~  RRRRRRRRRRRRR RRRRRRR R RRRRRRRRR RRRRRR RRR"R RRR R RRR"R RRR R RRRRRR RRRRRRRRRRRRR RRRRR R RRRRR RRRRRRRRR RRRR!R RRRR R RRRRR RRRRRRRRRRRRRR RRRRRR RRRRRRRRRRRRR RRRRR RRRRR RRRRR RRRRRRRRR RRRRR RRRRR RRRRRRR RRR R RRRRRRRRR RRRRRR RRRRq./[R lighttpd-mod_openssllogrotate1.4.55utf-8d6e417c237bc76baf78ad5fd24fd0bf0f591b0966961e0c5dfca03e55427aea9?p7zXZ !t/ᾈ]"k%{U}g桙Ⲹ9,Y,ځ_q!vE;6_}!uFv>*y<ś1ɺT4h.qmwgcDO ;5szYLee ӝТSJzw+ S YG#4偺[@I$[gǫkWwl(,Y͂+BjInt;Χ>`I kORJqK͹KJWf#D.~s:x [TvMD#f#'s[e@~]S珺1`8"9dȩ56rv` ;h#&N>5sWUD YlT_+*_ 9@H}WHM* )nxW/m-軜hv[\4wPf?dSIG,K4YW_)}M&:$i 3Er}5Om|>%9)b30:)۬u!=Kؒ#R<ˠ|;mdO0,iv͌=Eh"VCb_LYC}&wa&7e+ʦ-e];.],Y\<$r$NY"@WN1'|+;%y4f+fj`GƛB6';\GpS"MDHYaok>FF'1zأqȆŶ0-#uHfZPª-Eaad #KjvHx`Y?eڜT\D|^RlA Qj5HQO0Y\8i5jYA۽#xdؗfBI3I LM J*W>tNOt Ir4H`~|?`߁6Z-1A2BBQ<|JI(k 3ܭOV%~TS3=@cvHZcb;Qʴ d#@]w]?UT||Ɋ&C,1< WDvm]< v{͂MJ*TjRl;Y,3/z+6Bߟb_7bg K+ V㭻u*lHt?A"_1t%P&zՍaՈ˝>r9{mOdP$>xȽʁxG^/ڥ|Е%3N bLF}6]L`-Dۤ(}*jbb9μTo!ÿd}EɑL9KS5Wlxy-g;@!ol. 2419I/s\`R-L3ќp29nwZTY[|AZC DO&<%z#t $&Q~%'\gKPjӥ~ܲ\ !o+~:tBsxE(Ą(1t8z2;tK݆ onC0D#ES7 e#a8,d1m=v9:WO7^qsHW;際l.=iNZE$s5XPCWjBA.Nf{@j)y{ulGAf#Č*փDs| t%Ϥ?+H鎙^mԃ6xernNɮmy 9zf&+Yէ2urf 횘tJ1C\}hQK *)#zhL7܊v!3U_-e(X%S&V6Ps*>vATO">b }F<9 Ky +@ԏi1 [C> TeM_u}ydf0\! ='3Ł$eLz$vbZvw T5FKZ`j8;BCA0*FԅzOxQxv#AzD+:9IS)?,FĿ4ιo?Ts鶩 ΐO8k+폥4($*KSmlZi]@4#\&%ڡӧ6VCAݾ0GkdDA̿\=?409چ?{˫7\9j/cCU )~dUUY`n9KD.b~BCP҈>9\i)WU5"$!0gJ}KČwb)MgjVLLC:Admֶӫ 5H-ℏn."7󴙔Ejۀ@>gVN"I0Zwt.H7Rwv$}*DUi.P5V,v#lZ`Tbl 3.>N6am8Zoffk,yAyYäf7 2ŀ 5\R@+kQqOk3Q㗢0V2t"/+ Lx${R,6awCμ+*4$y7C ]!1Em` ]|b,&hgWGRW&O~xJ>Y(OLtDC 1@V r h7 &p#j JY!p .)u$0!2Hu{EzVGی"Ԯ , w8A+b>ZI5<$y^F;Ħأkr z`fQ{>6<&y7!:j6R,Sr!"w9ȴ-)aZSNx4i+~ e5)A|OuLe룚aL /0[TT^"^.^ǩ=ְS,fJvćrc6 G-!&c ⬧\1l[v,FmhpL$A K0oLX7"$Y+kISu:p. @oj@`B`SL38E2{Zo6{R~TIi4- iRWB@d'yp7H^Ҕe_^\V%05"-_U!x]Y{0;zgb̌+,3speVєJ٬)Pckpkg hӂ&&;7J'yfwt |D25xdLvYdFHs|rě"i|ÞsO[uAnorTӕd;B|SY-Hsw,=U[7jޑNu\L;7T0@ QVEWY ;٠I!Q =B=M,*RKkj#Ä$ @roRX+gsޣ*1fuS< LqNI%8N9`"/WBD?r/ UnAKOPN ]₨x1g=B'27U_V-lFWmIPZIQ{vRH5ŗ'a0"DK`L:қ][Spơ[]̜8630 H!`I|*N'n9a-ȝ])Oq+=a@m! >Ҫp )1%TRC<]VOId> ZP,Ǎȍ;' A|C!waL'HǭdIEU-dAJ I]" Tл]\shq4*P`>5xg|%GHr_Ak (wd kyO m4npy /PĥLp߲cZbLa{XFw7*4I>oTKʼnK}p3h`g75H6MJWOZ,󐃯䂄 Dr!EsOB?SS֞+h!C G>P }Ɇ}ԝtWKk5#I }yAcwWGQI'*+J 5@SRkg;C\-mG^B)2JR}uTs 3"(|.`ݴ]H;G̝C'je?qGUDdS\`,7Pߟw`g!,&9tM(,~m~۶f [x_G2|anɁ7.;,5Qkwv͎EX똸|K|$М[/,׽P(UR|fpQ,$%ʷ%bXwr[ScqqsYl[1jO'n9&y3ܠ< Q;fH_>:xFy[BJIrގqTofa7^ GP4!u>K gªILM (zrlfew<ܿE&>ڢ4Fގ9~< d#@/AnVV1d3 xeT,5z #j}NqL8hKJ ~n) DCOHM{ Q1:eMa<*D+j^ch%~J-D>}[A B Z$KqùG+]+  BZ_y`6y+&AVn{aQ7Y5q|=Pj&D(4Q.4߰5x *־ &KL.DpnB|} ȓ ny wIhnxXn[]!h0IMu%HvweGAlp$5a)Y"qWrd_f)~MЧ馽=S>*tVLGi]h8GJDNXzW4]zږȋ ;mCQexc14:by2p,^*|$_'MG]Rpl^$h_C߯B<] zӬ)J98ĔM9(v w 57pю>>NVA) y"MZ֤ հ줣 dVN.z4 BKWGO|?R%^崺5SE~YM`mؽqX(]yڭ2niՋ׹R_nߖ-" |-VQ~&E 3LtK]Yc$9ƽWW}xiX9~LVdZ(Hݾܯκ$(KT'[`f>)PfOԼ1.X}w5 wv u 2O Lz7߄_mk% 9#qžſzq/qhL-om:>UȊ}xk>N)pD]5 `'&H:w} , Xx۩)R~eJU^qOOJX .s^8} @WԿ$+B*0嚆Xf(Gg[hZk+deŸk3Z5쀑C*|Me1}Fdrq5wZLHj.#Rr|q@j8fŇG[mem֘b8i^^ yv@["%kUj1PǮ7t9 }jHR֢DflC﫯|4`,)`vg\ONݥDYpwY U8"7 6i$+ ,-82/`"{0VhO'\EղVsȳc'0Ц)Z@W#ҮI$15%8h1<]T[Rl8x jP,kdqҟ//49=ˆ OnRpM]3jf3Iu r+3u|% l,ˍꁾq*pؼIK` -r߫PfI5"4&gƻc]@R̷;-)8;uΐ"ůD Wo ѽU 'O\ )6}.S}J[“X{윪PqzӥS7сS*fW/ FS׿gAr`փ犧5QJrJ~ݩ1IihPEQ:]+l QjSX^bPr ..g;j8lJ[/?1%>_O(GGZPH{{0SWA(l~ҶrHIiGsNA!dԠuo=I`Ny7ƥz QWxc_SacoP{' ^1 =-eK4龳,\Ђ%3i`bQ7iR͔ʸVշnYY`No8ܯ5NT̈%{װtQɞl:MPhT B}k'B,}y"떗zIOc50IIEYe_WSIÅoڻ6U} A^-5+,X ׂMEVU2. Gdc2EG(CೀH.#deN3g=|ߧ2cET<5P?gI3,4t7|XtRBǘAvFVen4=^ ζC䫯hxmLo'>ZQYcIsU>d5R@P]SGEh/:}..;=!r =9ͥZ'pn "[ x>XzJvAEx0Sk].&( n%37yv+-~0YE8Ҙ\][1\3fҚHD^[׺ ԒO[-yQu.iڤl{^\IJx-L2WY_$%Xww>$(2߭㟗#@#ז^,-z.~ɔ2q cWc!dQ78ώ[(x(DRӕY!eP[,u|rĐ!IdtكF#Wd4> `> :՟Ǘ"LPR>iٿFŤ|.+;z>gJ c?خ Ջ@wl'A|Wm߮5IP!7-NI6=e;#o{ᕣ>㛪W9rgaIe?ؒS| qӺOT>-rI]U0rF"S$ z /7}t+;P q`4 y'/撃::- dfL:` Ba6㬭;R̽9:KU䫚㱿E %)嘧MU5IR}^=e*Y,@'a 4F5,eښ#<1:H'^1bSa(y:͆qrmgcyf*_Z`qk9ٛM6n Iyvhg&X>9nJYDpN ,[,N7W,tP bGNؐБG,~( J?&L}'k{At@,8/-)mнaD`e B<nL} J2~okvuO̚6Jʼw?Ɏ/7Ej3N_s-r#ϜX0|VXQ|}`kEIycߩ8EM0Sdܴ! Q+󴵟fWJʖ(xظ'tMإM57IQr[G #(yIPhfKv yIs" Ap;FoS h+'e%L s1\A#^1U:%,XQi 6t[yWfvw!AIv'AcX bGSw yjBӅв++kw+CϝwTЉ('JFOx%:!Jybx -_(c! (,Z~q,9.f{7*"'?_&5$*<{kn#6n0'eP²Oסz ʍ X`a`?T &-[iLՆeI-< EY)Zj?Own;T]m [5[I"ZcK_uCyY}ɢFa+i N . P cb2߱0tޑH k u,3_?bQՠ -+$qy+uɲ*lbbUL|]q_$*k Q XԛZ+}=Xvٲ먧ǣrMڏDmo@/0o`r.9Z.ASFH>("bGŭ, ]N<$2i+9`Wpx}q,~^u$B}}C E?hQ5I$o=4^~;LE2DMW$mO8̀e &}rDl-&(~ zřh2;K+qDXo7wP D/$_ tjnʖƚ':lRRҁ `ǿ.-՚o O|^j32Hr0s=.&DG@~-\ 6}z!i^)c/G EUD}.`ko*:!%OT'KSC\bwM6Z 2 !##6Db%ECNP+Ǹ`&tbZp!eXsC→b$Z =a18hSsS[Za3m66Nx\`ۖqJ;I2^Bu"%ӄV>S?j̐[R~ [qhMud:R0 n ݰP^.Niͯ/F(l&<{U*T ?1>qg4APd8k7+03gxA!r1#̝}UNH'pt Bxc+n`|:AG|6Qr4/ sR 36O~`Gxn(6t5Ph0 4YM.wnLn-Jt\c_(ת(qu=4袿('(^-$zFŖsՕ}i_MNDmZ$~ODߺ{1Jq$:ENm/#(R14}W*]|;+0.`p*Uf⃲y%w:jVS̽r밁jnBhtI`o楙΂"0mz6ۗt11c=:GJX|c2n{5Ir`h3dV j`D5a +cŌWДL!Zj-kQV] UoǤr,CPtN Cqjg~~1b"oKU^s@ͧ0U@WU-Y[)׊sܴvrw57JidYW]"$C~+# һ3Q <6H"ɓ~5ȊjG;TaKB}88-F* JL^1o߃ﰬ]`X "[}k 2&kϮQ ne@(r:͖f+dx6 ^/N!Ip2QT9Dn>dD7kACU|pxuɑܿ$ƣapVjwX g̺ouhR؝,%:!XB>+/a r̠3#d >z;Hkjle&;$c4j^n"yƛD 7-龍)PiKS@0{@Ztg\>Jl eщwiܪ/p5ʞwI7z%sO05 !p.Zg;w)3.4F΅SKN%Q1pĭke찄N&BpnfUJ[@T䗺(C[ZGqn+B2XoSdQKkrNH gˁ]}3!jHP7> 6 qc$"?xl +o z["y1E$imv."Čb)74Y䮠ZYco,F2Q&͟Dɯƺc.qi@!-T22O<]k`]dzcAd;]=/4cT=#$CkN9a ~oBcY`?)l3JA2"/}\yRXO]RґwdK&XB И0=Ͷ,eL‡00p4"5XyMzsx`\9KE׺$LaKsIGr\:fI9?3_TYҨ5<;㨩w3;Ol\ ׸h2'VlT%Qjj}b Hx21+HMZ"?Gxx#L?LR@tyo"Xoy0+ (~+1f%U" ѽ }ZHY?멜-&󚚆 ƍ J$ 3@89Б[@KdpKs~r<nN"!u4gAmf8T6:gnTTRRG _t=sihF`AZ`׳l-FPKֻ75aGH'թaw3G8ަ=\|8W9={bi,mBa`R$S>@q/9!9ocbEJ`Xs[I& T[~r"w܄8leJc1@#0@Zq ~qwI# ȀXb3x FO1K ;IHDT!'ABI-RlSvp?!I jؗ2U6yW7 ^kN|^"BqX;!K?L@h-QΜ$uh6AFxN^{<҄ә> ڥF֭CGC 0zxRK3?:`DIq3[/JړNF5]L|. WqWЃ,^ȷ W`w.ӛf,d szXْ|wP+<Wn*<^yJ_&֝g%Z G D d-tDWCZ QwyF5Pvvy/˿285zTwY۠evI>&kBHC IIѢ݂l?|&hHx!tHQk94q v`06wJGE˾* 9zNrBtdz7K ":;j`R z+a*hfU†LW_Gkw~덹AޏӔ!FLd ƒc`$\awYT-2iL/\VO)[{{HTU'R,Κ8'hWzk/*<gUZS d&y/5f[mIJNT)Hei,/9DDQ2N|Fb :k CIcZz:ϼ4fT;\I6}Hɐ]vnt[YIӈj K47hVZ7!+0C+у ⿂@=(or~q1TIJAOM+&ad1;2SS97KZfOK\WWf}Z~͆4k]. q*ãe65Z]lUj# 'kS Lا&5,(n̈=ilBugc%(*l/) (ڔ`Q7X$^ԗÿ#j_+ Xy0`~ؐ@ d_ƛM4ߊ|PSl`o}W9 6٫R"nQæ+ɜA*#@_Iy0%za^/m\yhtѱC*&Esܺx (gR9[9F- t8+0m70ǣ n^edPmyʻ"Zi(p-7[wqkIG;ma&FFڲT?qRߊڸdnܸ8 )h3loWWȠZX^OZ{v}L5<*#펮ù!Q|#q@m1Jꏴ^rO,nw֋èI0osk=MG kiKl&`Gv{8䐌^ SZZ/I'_C{՘&Oە3O~ | O^:].y帹5u,HK7_)b 9 2{(U;7:VyV@*5vn{!4rDqk^b4 6 bpp"vzފ0"y8F@t8!48eHT(x8"իeωzE*Kàॷ+5_k=_!hJT׏+^m{M ^2UFs7)tMAt1Q1ׄt4{8, |„Cfa;G"-otƅdӢH`3~H,Og r\_5}ƜE7@FOL_6U6MwN 6ǏZ5+肩heFT:x}Q~R92b0k  Om- ʺԴ(t$˓E_-lJGMY)>)}_;dCTfcHޤ-w {s{&XS& r6}i%U+Vާmz8, \,4pK;=#i7:E'KR"ZSR8)mWwDu^tAR qZ )'"%"5B5arIAYzn3D& ˈ޴rėoӠ|G,L^w%K"02LQ{pP+bpd\{H6^٢r@l*\b׎vcUJ H;?/|?F9Ukȟ/\&;3RW̗3A?L'W?KvͤdQt2*(M i2CIznUUGƤE9Yn V3޹ b ~pj0,@qJٷR4otQjb^DUzoXmXPt!LJ|2tN Bq)1HGdu`J3nRjB[lCJ hV~)kRr(oIc*bOTCam ut@gUbHN,|lWޙ,5KGoG~XUu1 _;WĔ4\ȭbq,`^5/ a)=*Hz>"!N@?943~C+!hgZjcϹ^oQzW޷1:+ip!kZ8BfhF+ 0O?lIL!㵩Ak<=djk7bIY+ zN;Ӏ{nV7UhTLty\@vJ 6*4>}#W0ƺ$hZ46yzIXNߙ83֜OS{$3]d|(=o שk.V[} FڝN=ےD&pNjq]@pM8TTL[1%ˡ4~cJrxҵcw=S4D3ƈH))w?<_AC$)o3zՔ6i;D"L(L$u'jYȖ,4*h׮|+x F%W7}ܲr.E؝PCܪ6\ U; F*E=([Xfabt}'M6aڀ^Z"eǣ63$~d7 =Z*qoHGe/-Ev rP8Dj-&PIsC]w14Ticgsq.K')6*pYn!Q)wW*yĪ&Y0DOw[ ͗eS(r!V/lLk%2w}/O02.! K;j۩hDi 1]^͂p,! g^n!Ih1t\bÎt鹩2 K.^V̀sü%dX^q Ch OyTMCVьOiK4Xm0SFi 0tb&pi]Ņyu\>^ 2:?I o pZ'7b$>iľNFlY@9U;+ghd^[|/\ʙZ`Y²Q3S''eo3_{o,1^9$Q+Q@$MbV$wt{g|eMj; W؇Uj^?ڮ ps4 ʗ%[^r7~=w*R@ՍVץ~R/Z7N5zN[$om!ž*mwxg;XmZ vZ?ed]^?w H3Vz 'k|t&DHs$npvcS6"Dѡ}!3_Qݻ בo׍BslWO2 wPk0hNbTE4e>ཥD;~> i-gParJV$ [ƘL m&Y>V6оQ,w~R |S΄om閿uC=#/Ng& ݦN U%S"=)Av**$ӷφFUCK: RJhіu$IڠfO7ZiOZE9 6t$I"\EEr9Aqsn'NR߰E Ns5/):E]@I˫X,^ F˳\eo=Y,,$m"5uo1FP#^EU<yL)YZTK1sbII}3&Q \|[(k7%gM:mu]7`sA|1a{7*:I NK qF-ZQl`B=6|,Y A nB!& I咗mGqP*_?  b(1`nmT_-{0e.?}3Gu,tTB\Z_x?fǔkIz@~ק< ƞR9ٙz'ps9ul|06&%Y3?,ybE[VEA~knڟS.!oRv2L8w'3Q te RL E͚ͺ"xFڊ7k?~w48Lo9EӦ7cxv'j6㮺'yoZ#w7{b ,RjsLpR%T,ƕS XMnE(Gk;#rX|$#L9F 6DMr/ mMq >H<5"FS,,00/fS=36C%Q)48)zw+)fǢ=Bs"OF;<̧':$HTM6ZՔj'巖%#Jbpvl|$w[{,9~A?ɩ)~ waء֩ˠ]'~DrDL!X҈ø !nDQt?SE` AWtp{QSYͳ&ύ^V_ٰ]4(2LR!lE‘`|g! Vl—sߥG6On1؝7eD!gց*UE6%zx!o9qK›jN#O 6f=|&8NCBU~ Y_(wjZQ^SYh95 -U_"w@hМ=UC'&X %-spp'OיP @"cQn= WaowK4۸(Fy`&M-;x kUA8uY^;v|zXr4ɿ)s_FNĞ pղ(rڗռ wp;m1N$r8ޡ22zR.0M+伫\)Cg3qL?i.Gc"wڍ$ # oLȅ'npaƷرL"sxGՏ Mu A"r#ٙ}=b~խ@Ɏ*z@& 1$dj~>g9D|;$nH!P59ury"(:>탏t>ԽH[83Ѝ~λ^$1  TpkQoLF)-/uUmX8X]F_-L!׶c:͜WN/@7w{R/$!r]t#~>LzrnqJ!."eX<0c}7;{TR*7XeXrMDTa@ KxNevZyz^$[W\cUU_46D;^Tܡgpi!0Au~= ԦQkDZ&jz)G2 BimؼN1$ Hb_YyHB\`lhΕv6 $^G] '3|ia.jI]g˃5@L0,I*)ַ9~䝂HxXE"SD?!C(Ws$)5p5QL$6 gj(fWT#B:x R)X5wvrCKKlA;>l[${:=VB @<Ec7+,Uo,ٵv_>؀$X //o`*Y1Ԩ3[!ɀW ]bJڐD/H\A)SYDGeR;6ޓ/rWuSKlv}@dygѹV技Yxo!I-`<%FLa؃=Y_ovQ%HlwBӂ|TR"4L{=%ɣ?1mfHN;,^2qc&V{^{m>0Sc B@̝ Xϲ==H<ίp 6^ _@VY!~Wg:PCKǻVwnܠУڳWh'˚3!cN؂5/Q'SܓP<|wSH4n}y ӪZZ@Rͪt㌚IWܖ]@w/qɅp-w ]o1e5!N;m@UU ~Z)$n9b+u(v%Ig2٭N`~k)z)KKX+ҥj7ѓfhn=͸r w\pctglBϻR&h_ֳ0:bg-3TqeU0 ̰B$`8kj3ˌ`OsxWgX{?)jFV"uv&<'y]\.M5th e|y-Se^"=AkKKH' [pǎc/PzK`p$MD>F-}apڂ  ";,{] T7o)=i2348C82[rpPa\rr 8xHmlw['esڏ)]0# >8HBwId#tUHFe( O5^<}P"83f*Yx4 Gb[WR鮑MW߱=Fbs]]MAo 'o4зwƃ ᚡ,U?ĉ᭬e׊6'<(u*'&6Un mmbagsjkt~3\DE2 F%ȫ[X..:-G[3`}}'hVW{〞]bf&"gu)ѵjO*5 Sh Ns9BZӔFׁaB/RU0^]\/;8a; 6_S~B-Cg1GʋW$_t*Ct.iɻ.s\WEWV>"EM_tX v-tgA+SI$d}R>Dg6#iۂoTvb ЦT\w""I-4VD=Mډ$0Jπ|[~$J % E. ؟ýI՘ ih/R+N_Y 1iɯ3^Vߛyc9( _JXCmcZ}R!t]oֽD1vMN&dDpЯ#[rP.Y{xo똂d.#W ^4e`wt0?)6U=nPψB4q-+>A?,-zpZ<5a|? NmpOSw%E aSg '(8wI-ysl6'%q{ʸvvʪen\! N j#ڒ 6lkzb pYs ш:@IFzwѬFIj4 w%yZNwdsg+s1ѺRy|c[!x阕Ne^U2lpٌY)=o1CeH :3E.W%b#Va ^Ohm1 .l9єY[d70e5ZVěY |*wBEj6zU|6RxX̠EˑHshe^o:"s nݤ |tj}6J IJjYD +y+McjS_%+i"afw>A|'ț]zX ~x n1{aVŲU]׎46zd r,[L0m!Yv~F.~ssMH[km]>0]xpVݢB< bGwo-98PP0t'/]m)_PkT9#8z ,c<кyZ`.l{ob|hʹ,lh'A m:) ,h{ڛr[{ dYpNFFw<5г{eT߀cURΙW >L!>~KU' 37$_ڍlu&Éji\t,ge,ZfS vyK`蓸y2[<{Y$I,7:Jקͮ 7>1,"g54nD:h-2)} Hih gO0]x0h%? ^V&Ki1g̚}-1;tKJ/S4R͔"?> @'!]`]3aM^E`5'i[R3izr1~0 =u+X'U$ ;Ub P˝mw^S ᘉ'>ݼa5'=k6J;i6T ѐQY"g@?:억NdTlf;^H Kx,:^JLBion@BcR.j/="/z ZzO2MH2xP خL }<ȀE ɦeิ%-'"7iX䏠rTr*C*ˤe&zMyam;aҗR(> LCl偆sb:}йOV?qzHCΣkP`ͳt=x$Brwջ6CьIGp4 ]^9tСGDЂ %DB)$- Ρ9BM;z鮘ds?#Vkw#G }؆vsݎ~6bWYSF *VP\\0ꏨbsV|Au$t"hAN9*^ Qeq7A)} P*~,*g#&(.^#<ڧj>1`_,m*l(^Ci+6|;s㔬Yvii tas|`H(2ΧMz>~ |]ICZ*j5K;܏vaC4&c. NNDyYI$Sj8[GBPHv?d1Dڔa۟Nq&Ø/[PSG Tw`};-PVȆ=UiVޥ|o侭4'H_H 6~$9\?0_ 0z[[\eÒt;'Wb3/,╛gԘ3pKr՞tE[AAayS5ZP=+PXCٟC<3)a&)5ndT}#  h%a+]u XߌQX0@w)*XxPM+4弇?ipm|uo~ ϯ A\<蕂/I]ygfT5b$lWx%ۧ2Rh4i^^7kK1Z:˝=JT^3vUB}ODcw)J\ac[擎w`MdrFVC̰3P^|V2ȭaHI0H_ImwR{ZH&&tg0J 1I{4@Ho^=Hئ@qa'k:Õ'k7"`tJϔ%$Yu#ʹoÌՒޫV'6L滦>"#e.AT$춿ْ~b+#dZjo-9$hx⫐}X%п֨&cYlm!Q"л1lBfELH,%IyVIVicS4ϖK'u-1!:ei4Ak_  e wu$ܓJS^5uTW7Oi1xkL9N 8`q k&@] 9CUx&m \ANP;]]?(4$[4.~AG?_j}Kcp(֜ri+&a-q?sG?w ]d>wo_]4hv* U9nsuiV&2FL>?xQy[__w!CWKe^';}W ^ܸ92KY,2Ɩ9enZ -]xgBylIXfieYYB´))/6@T+kij3"-ش4(RN>x:+0FBTǚ6~xTp 4N8;g^,m:\ÜǓ* ð<7[N$x$_Woe)ÇOIc, ~1foj0R8@xvERi^S5|j.>5椫߈P7@/TO1<X2zqh/M<ˑd2膚.@$D5woP VVi{_#rD["J1nN~u ʀIa6'c+m;qDddk6e [Zo ){sEug_8JUݕf -⼜`eigpa ]ޝ=V.Hi|Y<`!ʲsE Z*Pʜ%蟩g򛬎N4WaG]+W؅5y*]iʯNZ "AJțRD)M=4Dݳb§l}x̂ v)a?܊`J.ķ B\\*6/ j/+< 'etV8-VYSB.߅|o$4i5cS4L7O6`Mpu^Ev/iIg(ILZT;#ºShsq\.UQ ]n4b2ԅxǛ$̪B]C tɉx]KlH^59YUx"JC/`NX2U?^?ID3sQN'à8ǝgZ\f26_*nBJ'w=%]a*kƀɪwyn텅/ ;#}9]!z]01=e~2MaFECYګײd6ٛe)}PZӶJ ǬcdODKK)rtVHj"0Obz3IP/z<G$йa3 RGf;DA;osXuLk'g`zgscp sv8PE(QƑJ7Tżj5͢[zɋ6ot#t1 Wyj(?7 znpdGBr"V Cz7zL->clz2kZNQUb4/j~U]RϷA;-[m fkܸq y^cl kzeTaoT옙 _qg.W h ݓkM Իn_a8D$3ԴeV^xO_i~0F}Tlmw} G Ե)DA3<ԁƞo?'NWz]~]wK\$vo+h\j(K+u9Oh#dڬ wL̑5.~x8n >UDh0ԶϘ"CczW(h+"V. Etႎ OX}gsgRdآ7S4Ej@C` O/xsE.ֻ+^4aϟLpHNbƊN+m7Ju:u#'rI\q7L:L/C~)K0fRdFP {Zelh*U+fҹ?Dj@2}B=9;~]ZAtaWjц6}L7DY<2g)tV v<6Τڶ;K:Bl.QA7|26&N6NIG Y3p8[ˑU7ޗʍ'l*yO@k,VSlmߺsm(@.,xÎ.2v-ׂ;X49mg+hp$ w5(\Qr 4OGn=%y^l+ˇ5ֺ.t87^!cMyU8G|0݁ӡbǔ4*?{R.2 TSrj(R,$[^cS81apUC -LBl8U5,ntܖIZ$άj}}! fUWIE A#"DJq66+##" 2ۚ^Lazz1ZS-nʎCR d`ę S?D8?h+ChO:4#,1G*E\xWMj 붕*$/Vv- !17 {gd5fՂF0zWӗqY7Nei6>"yX/ss>D6 =[ =DJTޜ=/[-$;/ ?W HJ,^r=-v|Ό?}=?9Ku}j3`[52iEP  ܞ75=qPL քS.8OxylQaCpUJAPEq쪎IZxsKٯTjkmKq--4@Mz(S>"ChBmfr}<4jt:E,}ͺ\{U1aŔa<5s}[bQPr%e7.IIi ŵ:AK$puv ^!}s}z!אu4Z4_w뿡LlH $F;$Ox?"aurvejLҴBd2ȸ%$VjEi4Zh|'蘿A\/;]'@)%%̑ nk^^n}{h1& V=0=}_ }-}֠vy(E}b(m_& ~Ot ]͜ UF$Fxw`?C (_ݼA9J.N/PbcXk{Ǻ Rb_ӜVk4 bM{޲lIw\渗5n"3u_HsӌXNCY2nձž >nI+ DgCl(Qn-jv70~?3M1}m~|mu#s>@=0gt3]S Ik^/]%nT~j ͜~YȏO`\Ib&Pv n$=p(\S=wt}e8!"Rpq8 ؕBSlf'Ж(DMEyXZpFpa \8c_`wy"!E޾ToC*&ʃ( N7%-*>/ Et843  F?+qUY0V^"o;brN6be3OFNk1N0¸qښE`)Cg o`tD0_OUN!<\r*J }rEV{XEƎi^ ;ao#ȍ0v[zhj%fϴbpm?ezj1JRuBg^N^ݢ 4>ԡv*nN-O<@\rE;< ᯲('^2)F vFue%{UTh^*wL,_p%3LxQh/C;b9(l#h˾?;}7w'W"9~!f;8!+⡡3qCˆT24q>*5?y\RoaQCQ2#ks%h)Keyw7 }pML#0ifj2\2'8O0I{;]3$CZlU+6n7G Mc`wOc/W! - i-#JEouD| tM@ZMX'*]$,eCkph1^q6(飁vcIi4f ![㜌f~W^$` ͏A85._ W*"?.9ʐ &RS rN)ț :W;ك6M89Nka O 9춫d9(vx1*44y (g@aIߝ7S<3Qw >xa o05t`6qpd?rD yJLORL|q:!>~tZd whF^-+ȲT6[sdk(y+ (`RwPC"9TD.]XZ^5EbuGd퍢ǐ4?K8Rd[^S& uÞ\<)9YNPƢbnQ+=Ug0ׇ#4mpF@vp񖚁/Xy&tjtD`zW~r1ÉWesR*V!0)9NUظiAUo7gH"D!Q NbV$$DH8y(f  /ĞŞz޾ߢ,%ۚ LU7^z6HO! nb:|;, loyl@woF ~R t&)2 EdicNC :hfVk*BѭBN:?<=>ߣ.3W4?6&G]cu>R:'*#9٢"6oAHx:k-׌Auqg\}󜕞{"Ar=6\L5m6 I뫻Ϧ3I"͢dVp)ھ0`Z=I.*WK 0vH8LxğuiDς<)欼O{dJ?J2{ Q76Q\{1Ȇ{} V~P#1{ F-44ѝ} ][ە)*0/}: W6{@-l?](n|_yv kGZ-T[!,Qf}fØO) 5_M#uHzC:J 8 N.z(0`Xi[3o)Lh8AhVzwP=P < DNtO5T%-O05̬"gY$ge~*B43!?j:iKM֐fܒGu]++ s5҂m<ml۹_mXaP.ЂԱץb [u_9z^aK ݞ|A#<5`|f8xͤV~c\F:$s\Q*/) ;yHvt_!+AWTvɕG)0 ?Ns"Pu[_{zV7  Z'GEbjrPr}Ye^Zj/~HT.+3)PnSl Y?hֲAuǺnq+Yҧp"YD?qTd6m BYiI;F-'fҁۅ>',٢ZD,OY:VOZA^SҠ\1_2Гsl`͉'rCcI`qnK x!B#-_)]b!llVYL)Ǎ(3~ڦT)'=D踣:@c#zQ(;uUXU@2*o6j/#BogگX RQxtv\{Uw]|_Go_P5Kdt)3|AYiN̒s.g?ڮ [~ Y Nq&/ѣ?yrcF/hΒ=]V^7k}9^!Osug T(.|EMFc!9U @6)?8V)nY3ccv&梪x<5ėyRɱq#rܰglϵMkټ`І`BcOyıBDQ=U1v< ?k9m1yX\פ}TYB)V^[|88Nocq||J,&4Q>&ϵ(T$`o䙼_؁SKtҭwc#,;QP1eX{g~}io(5_/ 3[ l;ՁP_!8LIH -mf9&{g_j'S)d[]'M^]w‚|̉\ofHJkI3GCD3+%; c>Žµ RoUU p#QMC'jiƔ6dn=}FF;~^B]av r .CA.jc)10(m˹oDo3L_ڕ`A-)7tڌvminEoe\ws527[A%|  ?0i+{b<_oi"Ҧ߇ ;$wQ¤d`TT;e( Y+|Y9(h]}"z+9~E|YN`|ewrszn^!t]t I2ȠQIFokzr8CXl>4M%(Η/; ]..MǞ1}5]E `;1/eIeZ*2 _Գ Bاx/cZm3Bbqtr.#M@'B +ZnKM9>*lS~T_N1uE9)kYQi:1D.,qO *th_YÂJ4 rR?ʅT($9X@#6s>X`aDc~vnm9}Ȯ|kd,Wd. gAO%df7j/"pJ2.V`,/u- X Z1_!tVpj Jg&ǖH &Ch1'yG5lbbb<ݜwևczuͨ)3KX c,JXII6?kn&Z` ;^W?RDY2H:\'fEx(JSD]#ew^ JTӯ ,j"7O *cچ_7RcXqJ`j > kx.,pR_+ҥK 0R t C#s~.󤻬osZmB f_Ab Q _.Q\3dV6~`&$u:r+X@IHJitȌU`>fZ Ox_^#SȦqۣ'|rQ+(wQ9Ŋ1S j#Kx8ó/hDe")㠩K&?zwԺ0뺱@ >T|u2 J_ٹuwK^k M3^&b?Wh(\xENb AMff'='F ȄZZ6׎u%,j1v D^7:7ɊOu! `~]p5h'd~3 f(#m "dʷdt8QHh.I$& A-y3 *2{1)

[&ix'}ц,JK4b/h-ض{qwڸӾ~wDg  S†dKGC"&ifi B(L`Cq`6H z|8A*+"j@i#zFX+va&״72z/I[4V3@>5=Dy""xIHƲ?0WعK~>[$"\Х?oULe8dn3t~*rf{*} IM/2Z8V\$}OTjCA':-@Վ_>i~ Z/LJ Q$kGp50grhMS~e"x;j<*47yRI8uFeG|<. D\!;'xRC_vy:^ bj_pؼqAC>1f̡8*F+i^׽" &t}&|ZjR(r'@Q- sFHuDy"q}!Ga/aapNVr3!P *TI;wO{n׎0[NgEE2Dl9VMQ#+Y-ZR@99Z1D4e%I6]J0h(7oS+4$^V@޵0=$]?\{`C+)xl˟F{q/ XEhZAƧ?CΆw TNa(/M}o>k$|r$V` vk̲Up Vdm`*L^ DhB1Mrh]hy>:u'?<8PQlK=ķFkJI%žr|2KW޵[Sm3K//!C ['8NօLZG!R߉saɗN48& Bi|npNdcVQ n 2T4>by.+ݎ\_6B,cg q Ķ)&M)>[Hl.{%/$Ǹ:P%Z"eltOb,@ bh:7b5T쪺cmKWDr@کgyJ4,HSw":jœy}|lUjNܭ`)ƸB -3tݡE]2R$Thp<cSg[^#6>8^2M ;YD݈@ B;k>رn􇽋a_Rq龘C|li\Jg &wt/[V益Zղ#WC;F?$,^Si>(>7ưz&j4’hn ~p00PUwH_A\zN:SeA2eELf1oɱA*'Z Pa$2!TRjh>S^hŴ}c,A*r7'#`??Ȩ[ãq>n5$"q+ @/ ·qxw+us{_0{@ k҅3'#|tK4H8LGm*uA%s-oXK D=:y&uwKWHPu<1[s-ȆWo|!d\Ekޒ)HWrR/g?}™XR"AzvT in3^m孭inW$k;[>/f%i1K3,k$&7cD4tm>94&֓Yڠ$wJ+*w= пEb㣷)N+N]vOúu`y/FTBR"Z!g=u`/!S+yC>æB+"_ IfU{{]7(ĶzBLcAS)r(שuc^KN;Sg5[Bj Te[<7"X)f`P,[U)>0Cd*u4b SEsv4tUX~b3LYVikx70/RJ?-V0ݙu;?7#Y4~Gtt$XSV]=jD ofѻ/膕O|6fat넸!`*'չz몲Mek) VEkzX/{‚>U[Rӂ4a?-ǿYe<8G~m˝^$ہ#Sucr-u_Rɠek/-DL%Dzl R+xr?PKSPT[ɮCYCۄ:zB {[dNᵗG屯N4|`tffl9 hk"Z̯A:]F  E-vN8dl2LV<%"QQ^]ġ{AYIV4Eke[[snvuńdo'zAo@߀hO>k{iȖES:jH#P чe*Pc$8rt+JxJQp~X3,_j1U `<ԄB;cC0gI<{eU4'at&2 3Co."5gj^BUpyM|.p~n@kr-mYH3(YDH[8Al[$tH8.c]/ב!Ń\_wqDwk)FK^cFeq$h(.A\ksDwBNJX މ*"97oRM W MM/oTjW W* Bj%XDDaݒ/n2n2ZŸOh<:ވPf<׳ d{\2iDv--/mq}q_T`q<'7+%ًB~`Q23>N.A-`g:I1 ;ykT!`T/߿nwRE-+Luzղ61Z3ou/яGi#5Uh|dljVI㾷{B_N QI<%0vH`^b(w"U£b+-VY#qCJqPe*ļ*#Apj+7,XKD/hQq`~JihQ"}{pBD(yG-,$xtcq71y5AFuXmqqT `Xlͪq`~K::&`\Cg&:`,,tjcfhb+% Ӝeqg+a(} >/o(GsㄧT qEroބrIDo,TT\u/|{.\2xY?=13MxmVL_tL j,v꠶H,o$h4wEqT}~cz.׎(*mkl5fdҾK:ap4QZ]$y{ ;{bɞ)ϵ]pR' gr柕&^%^aioV q̶jj#%rfĿMN۫C{=mD>oEAߊ"/ 41(ٝMvj%ڦis fty{ >]!2U@7?eL//>u)VXx ]@n\'~$n4ݤAJ'mm~c+'ҿ}0w E.ep ~ܶɑP&@ߋH!-l+" AD}|`ڥ](fz-=?u<1%TcxbuطXf_nsD'-1rBt"?dCZr5ADI][YF]` f}lP7Xrc6Sw{/Llu "U~t!rH("(gA ";TLn[~Hxðq7C䄝ZR) 9DeCoſdm{/5z,[] ppW$+2g`!o~|uWnЙA'5G:z<Ͼ+~Z#6"0|!xp'LÎh +#Ovia;kk@B~a~)W }r\a*GI"b"\N:,- @" i R`8(-EC%?6& @xw3?.Vad9%/z7* ^9 զ:;s e4N}O4/yƖbkUUhkLϚn]ۛQ6V2uPwFm6)=!)Z_\i}@ "ιoLwˀlEe"5t\ؒyeD6tXeKbmQ8f!Xhg"_e Fᝪi^^cCY{7ǑJۯo8$\6!F}>s4TXp8q^+ ,ш] 9D} gV]`ȒAg je6$W6Ӎq{$ n|Fj-9O@ݚhrrNy׶d.sAjf٤U 45FO\a0͘W_C)rL擧ӑEcPqM`0Z(V8>4YL5wNqO1Sۭ+0とdEM9:{,}6 &(lA*$@&sM )|YU9-R~ܹY#vNкc*c t5^{{پ޳/~[_ӎm̳}NTł'_N&ljHNo."K`LrjDipO<sϿlRcT1J;="A5u9蛃\̋$:>o"+ l ZL8ER41se'0&;D&28e8NE7٨bbNg⤠՞ @Ӂ& >nSH-)[["G!_W,߂{)*%MW`{U h~ȟ MWVJI0(^qFMX([̏\uqlEI܇JmżxI?"eŽ`նE -Gؽֲ̜O 8 ҧs 3<Ʒo/7 gjcQY  r p[H!$4w,0 "dXւ<~OD$-kޭ^u!5{ DəG'A[4U_Qg^nܧ\ \EyΐYWg8~A}#(XvJ S9mӠ]`X{8RLK 9WByK84`;R38Y#PBihv:Ȣ`WF!B[[ Jʟa_iwG|O NZ> EOI*|ثXhME!>i 8T>6uBu "ceri |bACi،}Nר{a/5Lm@@f1Ppє˽c8$xﴏdވ[NMU;eyB6T8[o`JI%;,\ieWMg(oNiCY"Rm {\rt,\re1̠#̩k jH$B΃7&/k4㼾ȗ6HgG4 r'cD4zZ0#X|E ]nZiu4PhW?, Xv7O 1V_..*ɦ\K=3JiǕUj;$̓(Db{q@fغ9/כAn&jgx>fYXo_nZJA8s4#l\5(hj7֚q}'\;Kt>Nh=@ '$#XlءZeQbb(fJEw3Zc-!=Oe8jxvw6{pe[EQw:9k<0hEoҔ\ޗ4(9w&  p -c-lNVrD I;M|褰Sޠ#hХ {8|H ȭW>g꫚RCAt3^^4 4F e'c!PN34 < c2 rn;F/uR%VJLN02s&t`i9ҥAh2Sƹ4^ul, "t=>ck^c䰙Rٰ0#QD—Lj]@,O#ﲶaw](ivUHUS /gN'2HJދu"]Jҷ7;w~5tRn؊A&*@\!M Gk{5$D=dCRґL=TE_A-/1s5w)|m%>Z /Y}&=(+ڬ"/-O [2xt3CZ/>Tt^H-?LFd^I B$P͘gɁ;oiƗ_G\ 1?flAv`Ѯ\pWI۸W~nǹ7 ~Oes 5ngl. :pNGV%TQÍ2 "hKՔ0Ì#'V ^=vIF%yL%;D:B6Ĝ[+a|D07#$p1a1fb{0vMX#;nA6GHK6ժ#:i}4ab(uC>VqPw>/d^B=_,9xH};ꞳME5JFdI $cdC%'kH,I@Q@RewB[O S`ES|ery&FԖfs_dąc̴,|YJwFc*)JxkXТ 0}%IqN4~= Z81fp^i*,bmf/`#t > 42q V% #x#CX ġBns,θF{ּ3Wm跈ԼRAZ3WW䖴2b0 ew>HB?,8elCP,ȁ"x!$e)nnLTqbK$7C؏P|H "+{7'yrKd%km0 84iB}Quj[C^MtφǬDo¥'vMA_ҼN/W @ Cg^^1Bo%~(8Q'T/Ҿ>qR H_Ed}g]-:IFg"!CvDq/:=)&Qq:aΗ+ZcB;ʛzC&?sf!2Ǔ"X- k~gLά={ '/$V++Bfo%u;|}gk7'|ȏe*)1& VD@e2B aa86)!yyX84\ȣ5 BZ#(㹉*Ɏ|p~+fF%U21ot9/'8.|yQrO=nŲ?'..\M.5 y ?̶ ,=dHG{)QMij Ԛ.gޒrS.!SK=ϒ;$zW}d&H9! -:=#;_V*d<9Zy4dдv"_͸z1 !a`Bg'(Zb\+,]*b0(E`b, ,W $=n_(F#[/_lS XarU%xomcvJO<!B &}=-gB2# l%P*̤e{p`:":1iԚ۱ mc ŏ[p_8>_̢bl^ 9yBaa?†B GQܙaV4(%EGʆ%>$ԥqƬD9-NŏeXi]$E=5m]ZN!&C4UB^$ꃭhs?0{k$j_2Ii\R'm5p{.RI0!1=vsU=mWQZfŇ!w{l{>rdBBB'X^MZ0a5!a_7mRʟzkT`2N^1=m#<5sO |1:6RMhΆ~X)P]!T(bc\%Rv(+(/',-fVR4!oFx|\/Eځg,>Ts)POK +{}0#9ae~;G4@t+WMb ޴H.-  ]L^qzOhDM_J/H`vue<Ǔ~*SMILf!H0[)̑%V!rfk")//wڐ:.Xapf MDWXT7$yݴT_˝۟X%((D e^a(ͼnbyG}7ٍ_=2?[@wݕ9P@}K+ [ܧ'aCy3h=Tȑ|  Ըr$!*^X}WĬrL@apm2jcD5ZC|vX 0#*y?"o@ubTucufir4h=OQ|,syK$/2tiHœ}pt5h##' j "uڬB0INE0௷U(&/ 1)Ns:l`L h6@c2,:zcLX*ݹз2%*B:Jse\os#ޭ>Ͳ=^*! |b|U@`JgtcVA'*wO2;KjMQ6CLv8gבMגUNtlawg[L TL aa|>@Щ?If AJ!Z> W2 .HLP;n'\wjc /iƒk DNuH02Gَ)F#7]:P0js%E xz>xB z DWr :+ކs k,dx7dJHs5R51w_.B#%&O$Ux-g8C?#[6e?WǠ?46t $UV[Pd!gxSY-#e[yaBe‹+뼨Uw( ,ի4Ɵ}kb\de6\sh`UtzJ K@:iHLYV Ո|WilO#B5~T{n|9ndHR- V<ï4Jޕ~~ESP uzfƄNnzQRՍw^'~:oqĜc YX0A\N=pY=xfVDc ϾgŸ0)9} &SWǁHFlC#s:LO fG;Efyy<6܏Ǩ_ (8T;O LHՑ%X9m͙eNAW&tupS2p>. x-cB#YҮ*]X 'ŀRiBs~d/MU ՅjHJ1 \eĔ.fO:fa ~GAz^]05݅r4鲀IQYUTLbQr'إߦ[ΥMvE ?]sJ9qv%!ӏn\tҽԀ)90&[rXOؙdASA][T;*|*n]Rj9FM]6$va!o- 7(L:5a  OV93:=T#{ P k(^nJvi?I _tR$Y~3eu6(o!qsO㖑{'= ٟ8af( Ed9=b rh}toJ1zGl`;-gxc(bubgLS'3V]0)_Ɏ/eIr1zio\>8B6JHuI`[3= TTH=RP#߀aFRRadRo d}طG|T* B;RȋڐLK*6<%CP>ۘ)B_92nxI(nR N 0ilia#Y^5vS9̓Mi, "PnP%zBD >sCR"AKor.RdAO3(#$M%H-֘ҌIǧ(׈+1|Tx\<;}\wdԗfZWݝ^ƹEMV{tKqɜ&@*oN햬׀L-eeG "EDFIJNjߌTxݨygd;c1}\%ny'MC2TKO`3./DE6ì \dVgŸ(4l|ԎmжH] Am >UDB }8a'CnƨX.x1IQ_e+qnPwjҰӇy T{'xEw,h".d6(:?"st$ ^к(rc¸ӇboBĒ "e8:ycA qwվ  WIP!#`ꌭv&oB-N7~,K)%66!ոUPSyҟT pE=5k83iG.cnj-$`0 IZDZbxsd(z1g}`O]EM]1zp% jGNpm5 =gN$R|^Xi%4 "^xb9kFkd |=ǻA5lDuC8T-@5D8i׵v=atbفɀ+Hl{]s&G~ 9ˡ%z 0sHv WVe >Ǘ= \t֨b7wyq1$rUВ-{& _SÈ[C!5 f7ڧjtev0ɺ)hھ]akͣ!1\>vEĆfm mqW\uTMٱot>q2oˀX3V$`K{)t"Ւ"Y?TUz/mhՆ.(/6j z5RHݖl zV8JxA=WAhvb^԰]dtZYOW5ٺ;<}[G>t-l7l/Kp% V06&uŏJ5`Ch*rbc5YxEQs&9ltA:߲ݪ8 1ՙ;H%V>j)|ԦK" Pw& .{([e袆8b) du^lkFBr75i[lJgOWi5 冚f I( ӆ$<ؓ"z(}mgOahpJD u"&/BwXq浍Y؋p_]t;N\bۉE.y૭Za9c;pm[R ؔ nKbrNChݟ&v]#!VUnMƱP+_@c{)d"@X9Y7t'4_QW;F33a@G[7'Eyf~rC-|.oGnw~GlD8@+/Dq](=yt#A`9IAbL?u7T54\X3H+I ͞#f?͟/<6OC%~$8urT;zGT@C이}ɕO0TxHcXEO3W:㛟y2C^gnT̲&#gI tzM|х @ܯP6}OkÇ۬=?;YgRji{$Mqu% 9:e(A:"ĕ]N{a8?.j Q`r82MZ Ac'G& \Q\/{'0vfq(_K l#$N~{7 %ͭbv/uU^?PzeuL0yBb܋a4'q! 0ZDS7z;"WgVz$j!{A?0z *tF>;>6]# 086H%Ԑ` pLoUDQƾ֪^{h ӥ/ ϼito hIhjF^.ipB#-sf$װo(rWuzuzy.o"Lgxi^65}^R0 M\dQ[A˯9 u}ƶc4[(h>t![+$LJ%"f.7%T3nqPBunRNf?v8Ff!Z?nyf6AuF{ SՕJrǫ+t6Mst1AOx'ņ)$DP"s??,/] S504Y{1/ W!%O|k0X$]D AxcbmoIMޛ ?ϝHE-dS#ӏc/-I֠ -Go&$PI,{ [L([{r8z&i#=ҽS=XS(w{c_<:/6HoB^ڐ~|OɀgGB4[ڲx谒5b!\oԿT{_Zmkf G+ZV0hv~0555ĢHD_vEZ"a 0jdq̀ruSxC߁G@Pzs|-1NZ X H8/[H ZX~Oi("UxZōhoF+rBRRjC\(/1R{6P^ے}},d?0=%okRK8LG+[Z#$[-;0 nA, ]j(OEEm ʼrý@7g&kIy'6wL qCዱˋauبvS (@`)wW +pw'7/Q}0{<^6FQk?!5)L~O7 N4b=c@fńڲmΠeIOwdX>(v 3V[qۥ_4ީxzy~c=[09B PsU%2׫@ K'e7f+ApMk4:۠i>9 }Ow sh¥8=4Xځߥ*.0:־-^dAW &&Z\>ăKRy/@CPȒ<$x(g$,oUKgQ5:! X|sɸ* %#\6ݩ0҈lgU v[Ӊ)FOqXTPa)H0n|Yj(=H¾˜;%,4)Na&̤fmu4{,vE2T`ElkRDE5~eK8ƾ󵼆E <1kJn=^tn%S(8VK=E1 T,W;x ypGg<[6xm~%ZQx+Es?wتTFS ҧc] N .>ʵ!_f{dD`Hm [Q͊-%sUvs`NH74SwOBWxt.*a@_r+x3#f%;ǘ#XV\d=,m#L~ڕe2*cnX:|ezXsu~$N8u|S€D Q?+UnZ\q|i)b/Vj:ρr69甋D-P ۓ+UsZʱ^?3/$6Y E2onʳxu%?1sNsB}0ӝsY@J* S0NSP ״֝ҬSֲ .nxd~KJ#qI$}:O6zc.47\k]*_߼6$LPiQI+ߖζ<qWIjܨv!IP6M1%Υ-q꾸/XpaUSZþ҇S O27b g&2JbQzbm/h_s*]Ye=1ߑJg㥝/|,A 'tWNP}l6JJ}vS0XlcC4%N@3{X㟤*~N6dij-5i<nՄJƊM!G͞YW(e9G.N )f̒+HmBDBdggU?5^ ?r13gfH^G朂Py-5rfY6QV (0 ʚ[OY^ZnMȊtSkj?)* BC⊂ঝZlh!..ܨPRs2O9OYCIWϦ(2P.>:hR*,>*Ol֞yHM N+]}YthۻtyI);L%1h&]G/exMHݶP,~iޤ;QqbW/I kZ*B#RޅLU^f0͠NY3'[)݋Ԭ9[WhIA։uDvj"?F7,E7+|W#=r6Dt} v?o,(`<* ڟ~2X:3$[mU?(@<n:|k)#"K8N73{g kcJ=1c7\F=-O3.M"~E 1D]i]$o,nraήvT"kD0AҘYiHzXuͩ=Enm+V:Tjhs뉒 Osgepy G P` vt ~[SXkec=D-TrT9s/s[m0ߣ*ƃh<Ϛ+뙩c@zn+%&8_l۝Z$Mz&@OJlr%k΃r>gp1jɄ%u*@Bt0*47TbFd5{=>?$EH_ k Θx>-$ЈPj-"U(nipR\pC(h?kчVŽ9_q+m(i:[GqQ]y)Q]hIm?Տ}Cm2ٟzI3]H9' sK}bg%A }ڻHɑ iesH{p E"5\4HY?SyH[ w vCMD7>4IZ*7cfZ\ȴ(ýjSSMBN C-xկ%kY#a:tۨtQc_.VVˌ?6Xϳh!X0GL5ƨt+3Q$~o|],v["ˁ؏`\H(XjtJqn͆03gNlmL-[=Tܬr[jAE~'̐X\9TI|k`Zi#1&Y `Pa8KΖ;ˣ*\S\`ƃqY* {Ը];a۰{o;mt3=,MRbtCݵty'R8`EeR<7/׮pKtUDlɸp |%ظr>8yJ~/:r'96#Fu6$pmq ؾ.:_A(:T_.=.,wfBNDL/p+3+CA!!a^_>wfA13= Ɍ*1ʧ՟OAE%݃}8 ?qe)B=N)*⺡ɒZpehVYºhZ Y黎m\=`ytFD#2<@ntlro(T?w5֙[7b`jL-[/-5]p^OŦH6SΈITHCeUzd Xı?M{jHe+d$dT2-ƙa<ܮɮ>ݐQ*s-JrTLufˋ+2oիzx ~hׯB)uM6 B|\ke?ʏw픨wŇG"?9 }U8{t$<12 #5A*Wnw'h smTB'}HG։4;̼۠m \--q0'.@ER)UJ` ڬeTS)RGBUaRRkܛSD^RNx~{ R/XmD.F"(.jX'¬`xU<ɭ@w6}A^8;NXo(FDl 1 S*>txZN@?^58> g6ˠʜ;6T+ NlrZܡ~bf2j-0ۜ .J:pDZ?͆zq}^EۻX /@$YdY/2=o^5F$vFlx;ƙ\UOi lMqpBP3йTء5}l}:%w|/ :zٞEcH=Ev͎m.Tͭݾ֏IEǭ_u^-3pɃz}} ɷ~:UtcA3u)'Z«NSWxtjNoH 1eVp,U ?t˫Ց R[2K9E5ɖpý Arv 457b9] 2uD^YPjRU v4VTZeN)!+05b*4a 1K iNSEtՏ0ٛj1M,.`t|?G9lCpnMaG_#6^ 1=3ktxzn",q`WGS@pBE覯=2DX)Wt LZ!s=]{yZyf)Wti{QԨ35>:ߪPId\oߝNeaa-I3 72Opkv`qn$.J,_22HHLIqP<G)8LKo¤-뵁{| unN"FZj. \G⑒yԺ%xoR&!޾nV^r`dhpqN8d@h+)1yЅ#U(|c rqL[nO 8IGK:bHުk r)sHNE<%N9[UGY80+^xOO3Vd(9Hk?-ݜ*7B#AH~<~g$&H ŰɌK\ QFߢQ.[aykV0xI8AU2(JzcxMe3m4gc[ S͵"9,i՜y=Ml&sG'vDcA#G$|%RO/mqpk˛5CP+8d˩z%,)`J l> o}l9P},|V}YCC>lNLrI\;ъO30ҊsW ϯ6_Y_~:@DuOE`Ξ{d;[!ڋIǻ"W9v8.mamDam 64nqX4,) E-?gfDFV9W DnmML;r#Gz"z?h@\ܡKGaD)KuX1w[/RSB2hz[htapn{Uuj(&bB'91~`:⠝wP #B6q[+z;#-Y!bqkV+G,T]ma8=LP2c%տb/JorxVܷ_}ʑ u8Ma҂Olt@>1? RRI¥]V~G^xmEh$gtI@STEAu19yH`u\RN!u #Q@ N8w[5]@*)llum.ONw+zhOF5LJ><-g=|홫U༻\N\ٺUx:33% <f,WEwkF5r8DoNuZ5hI !=ns /%7|ֳ5[y;{fKՈ9$6jPcʌT-CCuwymb]%\/|\,EݞFrj9kUĀBp{v b+s.]ԭBJj͘hkȼJ[M*a3l+pEt]5SgtGC/D$7TiR@o2H ;X@3g/Y"&N"933IUp8,F`AG_>ʖ)teg3yZ@CE3"-!ss3rHqM&Q +0^fa?q5ZI̸- UMü?D\\Ч<'&\^pMC}2o/L6 eHI|2(JEt~/r~yHX钼ibtXo]`\!iU3~Dw)hk^{Pծ`F-U-\&}&fjYME:q x!T0~Sn(䯇p$uz5t c(fʹ2P U"˔ ja^Z]Lmh2 s{.)tlx1@"LYޗJfPmlC@lqjOMGO3i<'xܟpLgzl;34d^Ed00RDeʢ͠M6ǟTp @S͡Wۖafmg6X]䆀M.(a w+;֚v\ "85邘}7]T)f&)QSP 9DJ5Ƙrm{pIM t!# ҉l!5 &]ߙXBQCj)Rsm^ӕZ"tvOmu!TRr@}%&0SR^K &M欗z3Z-4@̲1б3Zb 70dZ?OqAϼM@8~Q_/`[o%ˊ@ ݟ7dFL1᥹ k LO^2Wy_l[A>i^ʰچ>jrS9bbB WM! l&(j|P!3#ߚb74gr|S>u4ЄS7}߬0 ۓ&1iuCb@wfa9Cu?TH$E`)7Af1N0ǧ9|OhWI x.Qxv(YyHih>ʊ[ o$rkҁ&E'q%"Z͙a7̈;#{:ŋީw1/U2t.^,\@ c/6M"s;7<\7!sW cH6cSطjփII؅%/.VrVL1ʞȄ~ekT{Dl$z}Ox+ HF_6lۣi=2R?몈%}]\Ch 7Y3{Kp A{Xo|b'`z -UZ,H Yz=|ldx *7xiGdn-[ZXb a?7b+/%FFC!1R޺0[>"}ZZrNޭfx+ ÷`[()68  5ذZ7&qy,g^ \p"fcz.!lK>_(va;~Aj G*37 a/7K;#6O^-xJiCm ^]opVX[4/=/zMu2D`#t'>1«zRrQ_Y׈]&(m%Ivei`+ie LoߕGV-r~YL[ѱo m'E&ZZlibzk(µy@cmEwER?حxYc1D'cM#hN|F!*Y [B|#\W`/ԆJ8{ܞzJL簲Ws8yP<]vRal_L5ëu co ".;)a/q\~P<$M[qaF3Xş)FF6+vmݚ2o[x/OcDmڐlU {5<*K FjǦב 91y=.< QPW [tw+Q @T"q )9GY,q$<:e0m5?K|u)TR Y#;LXYO1@|-QUK_xg!e } ӱ@,"y6/2z-:UU 8N(ɎϺTrp@NZJD3⦅CqK\֝e}ϸLꬬLNؚ!@o}*&f;-4!9v-2NK0~"gxoj Ngjz>c7o*`87p"AxHISe*MR$ Thq6/.qfqm 2ר{oЙ"ҡȾ^Eh/G)lv7r |waר7P^oB}1 phfJQS##1p袐%*Jjy?{I];#Q=̣wr3dXW~%UyWyw-XB55 風5}}3uCzv>-TFmp ɜNX 89#=WLd&O%\ 2@+`-O!}Q Ea<'''$ɽuqЂq+~|+/toD"#0y3:0Z:i6OZVtQ`;xro3[~?4?}=( IF9pـ>Br$~ĢHgPl g@kq/ Yƾ(8; ٓ 6Z frhI=H'BXaa!Nbb}%}Nm*j2 S%c-"0,pv543ۢC؍]:-WKJS[6opPW^(so-`8Hj'BH Te穅hK] WRcVR tuokʞh_A~~2 wǸB&{S^L: 6Xӹ]"YYJoKڛ?#7+[j…%#b2b9]o 9궝A̝Yd oTI3-BD&AY \[2ɐxsRLUju]Q_1)wQqtS*>~PE (NtkYɃu4Ⱥ4WZ[O~=z(Av݄~ԏǕޭktP=wGTJmpnk,9dɮ7MbmLV ~P[èQ8%XW.\h F1yA=a4Gq{0GQasg XGhɧM0|8o.Q9LTΝY"T!E)=#俐7 ('S?ZkIL4vJ=I/nwʢs`hYl4 #卦OHX\NͮO,h?>{EQSP{WbhOsѥVhܾ$qe O8r\0`Է߷JBTiXxQ}*DJ. P,CE;9Ug{\XTT'T%0EYW\CVJ; Q+G}rשDq+SQ4T bL_"(V<;P:ŮݤMQUDbՓ`z J\;y:aO'jK GmJ`L^X嶮C5L++I GsJyIƸv䱖LK;iR',^Q-8lu!P1,OBm|+ vmp}[GQ=k+=<5eT !|x[ܵѷl945׹A&xMOHcW7b֥[lҕxZ_=oxL58di$hEy3@N:__ԀcN ~G#z҂#\KF蓂 s;{^I2Nc"$݂j'~apЏ[cPU-BZQLB%WX40-piu̔A"킫A󑿏Gr3C2ۑHxg o\G`!UEӦuU2c`'"`{iM܇D BWUp.6W Z"EAWTE82 7liPRHBRJo'qh}wK׭Id|tef>]BZu!jii`~?U(hΒU)2 }@M *4=tв:xBEb1|\*S B(c2B]8rFO=Ek7-M6ysn >a\l`%p)/ VaJ_} |b2?̺'MA&sջ7ێ0/9_BCwO絴2?N8~ke{(!5k WxNpWa QXGM\ л?6GcNV84_k,#8-V !ݠSx'eX&Ú<W&=$]7/(E,ѿ8bk\ Dp9oax$/ e%BpCK*4BT"OG@+{ ȰakG*o.CGmGUK0BJ4TWÎ웮.4H$re) s$Z^ huBLz ŭ/CWXW N ?'u"-![g}h8L(d_F]T )ͯNĸ J1ސDxa6Exi# 7T0~]+>wؒpKƍƵ_OS3tQu!;g)ـ]bVJ0VVeA8a8ڊ'b>ka֛.b [;_]7&/EJn f. jPՄF1[z(1c D _G˄;W1@#޻B{,,孝T؉ˡ XonO ޑd. ]% J06%ަu4@5/oc(u#K"O]pDu FFwO{: ]L)tf.=.s)i}D /öˉBוL:S>y Lbi$~B4٬h2H[+}PeqJEQV>n|<4,XfNZ}bl$f 0QhLuz\C_<)ntv |`VJ0*?H{1[znԖQaӍ|G˘aŮ=h !@@SFFYl!3p`zݜ{uGN foqWS+ljD7ķ6 %_@t͌{%!jw`aɰdqP FϴHeli29oZϓف<63f Q;m-0~iī6*Y ^Z>ڜ.Q$)au8I  8^6^o`!h۵_FܩBj|sE]( E 'L\Y줢|sEyIg'z7٬^ (= Gr!wd VFm7Вȫg2<͵KB ~Omk]܊=7u20X(Ǽ"* I׺Dv>ҊU4'nsa hrl0Ʋ+zKF-'~aVZvaY&y|u7ll |Oꈽyf&YC, /(h5S7H׷ kgy ,߻)>]]0B qeIԱ]J|0At@IF~ ^uyfUD<ە_bYGukeS߱Aa6ʫ5~܀e,cvGssB&Uk>[83Ƃ122 *(+F`'p4$V$~ۋHrTW0'GHgҵd%IH HRo~ڬ| uOy 9RO{#yK v>@?Q564؊&fO |{ ն6;'Kqa~@Fkk97n>No8Naf}czCr]A)k ~(g]&p 'cOGd ?gM *G$2NrXt:dХ,MDznpJi*1dD BnKނ=r:^%Jḙ&S9*&aQ4~IK2,o))GM?EPi勈|H y3oGJI4~y9d3؁{6 6+5mA޸-v2aF2i:lC.  u+ERdZ&Nlrr& ΩN~|ؖuu" SqU[/ނ=kiꤷ֥w{R ٬2`gg:*6؅De'Nf#4d=i$#kٵ[8ܯh>Jg&DzM=?RvgZ4dMynaS:=fM_E*/MERW6[pS+G)q25 ݣÀ&_N$ob/=6aIzG{{ɸ|`ЗG߭E8A"E #OߣdFiӸ j-MDn f}̙\,W"Kǩin1:T^=wyhy>V0<®IJ3ngP7Ч pfO#X|$ADhc_,oUE4DCj oE\lSw0%TM(*ZSTUKܨԑO'BV <q ˆ#^ sRh'9R ij*k TH2'Gs?4Ԙ8$ ''uMӋ%"v+;)rԛ41a{iF\ ) dѱL7Zx'qqJQ pkV Erώf};-EuDE DPIVC;)5Z N$IQ7tb2S0(h\igta0A:_R_G*Ou偌+X5NVӱI1ԠpĨ^ʳJ?ƅF̞|]bJmkШ5 ZJz鋁P<69I Oo.d>8J6KDCmz_ߎ]SUwWx E~h- ;B%z%mp7nJ:i_J.:,\Mu-IsOS)6.:#u߼Awb{*3}Pќ{xp{o`A 8 [AœEXښ/`;6zv~QΥP4LֻF̄4M}Ջ0J^GdF]ѥc=^qaq0pGBZVv')w{Q66)H`ygF:?[ȸ=#sW,ӉNDA6OK[8R0ݬ&hs|*E:7"M/&i"L۪l.ӬT[ۻ*W*{j 6pܶoVU|t+aOSLOzW$_є6/Vm|[o(GB={B3v@El90[t$W}43';h4@m"riTfS@t4Ҿ!T#GI/5bMGD2x@½8*h[)QPD|1A0}Es>It:W%GK> +:!Pc-j^BKY\B-dUNA&BE2btmz~rIITSԑ;$/i!$F@:tkqCY &fybQ% L4rH}[lu$[N(PHZ%1]t4|KCdcfNBѫeDxZHP|_/5gEUӖ[{\sv8M@D}+dT"pU9`!I3ԚjDP|JY}K +DIW#c/z2޳pQE됬fPwX\?g o5Ok_$A%ds(fSW}@,1&k+pK%n RSqծF|5c49^5F7W+8b38[Ih7՝*769,]ggNco8rt|>Czԅ̭*JNEc{X64EE9bmy<\VchWA=+iwBnu\:It$׎Ń~\a0%n}#Pу嘓S3eJɗ'l5 k9]…"&:!N>ZUyܨʼnlgoaݞIOVsg=(!Z5>t=WR,pʧ֐o%m/'ά`РK5Pk\Cs2,_'3a+9x>W>wgK3 Ew0h"l'5uY׷@ZG Q+5fҦhGJ|h7%?2%t}ALCC(1J{DRbvͯ[Gj[ -0`sI%gV5(-iBni ee!$i#O$]f h6籜`i g{-4v:`ͤkr${6mkbDsʫCU$(;&/Da_bs՟Fn >VG<*4h4.[q?ޝ'*E~%+.F{լ[0c_n Y,h0jY!Ȅ\ CAB7٬T5Zi\[{f;Ɩle $luⅶe!Gw)DUSIAtXMiaՆl\*i70os*2XZVJ{JΆ16T[OjV!3>XC%Y!rH8D{1`T7]y[dlO}K+9sOǸY#LbC&G6nfC +d7͠^ZρY4Vϩ$" .u6N`&S8l,4.W*8{58y۹ҷ 9BϜ;]=0\Q'J4R`3V:8LP͖_^E Q*ۼF٭wW)۷=`Ëp&qE8J}F:Ɉ8)ûTEdl +'17-~d b" r e?һ+g  cF/lW>!v2+=3>D'/TTְ -H~|Pb@6DO*m~?nfj2}擀XH̛8a*nnpJWO6JPJIlRf^w/`- MOh}vX&T' 6nJrn|Xa-}ž@hMS:>Ԋn:=0"$:& < &f_5"F˻4*?RYvž&88O5%`יlmx&U >(qK1K exq&ƭM0 9G+c1U&92ePc8Ūݘg[kpݮ o\߲X {_kWWScFޗ<.뼰7ɨ6^4B6\JƱJF;e4i܅#6Q;:QC4]%@[\tH>n@QJ-Fa{ HŁp폇DI"폠lBLu1&N!=rgP28V @1tQ1iZ Wc㙊Iz<дO]cݩPj{ӃRϺHW̠"X $(_\e'ۡ剩C~ Q{YAVSt54zo; 7 źeA4yɔP1*Ք+֤!OX9ѩ.sjqGC#/J/+Z.^LX4C 6Ǫ`m X ,WهT.![oe8̝]ϭTM%g ѣp=^&Sh?%R-8j-Փ Ea0~& SSs/Vi:; ȆPʫ\2@ R(`Rz{SR# 1*fC%g'5kYe;W-0=?8 NJZ_(n$ضv/9KtL_?3Zl. 3?.@ڒ2}aKO\抿/M5e`=bPҎ6n%Zefԍ7Ki+\uD;P"௢1*@`\M_溴.84hoP5Ô ?ϫXp,+q @ٸ 11W%uT=s(M%.Ϛ?`0rsRZ!fb[\!L LkGxYLֻ0RQ Ğhݿ?aa@,ufsćg=r)p T˵rhHbMldũ"Rn]U'=hN[TQ8}Py=NigK J)Ŧ8Hi:jn;n ə_8Wft,s uٶjqg]v5B^Ǹ?#Ӫb"dͺ?c}R"K5 (4p+qERmYHql-A:a͒7)$`OѸw>Ɣ>=ttO jYsZ҄;blfHz0/ߌNFYe~vѧ?qkʹWʸM[ a/mEGJ8Jy(劤j»[Ӳ֓ *)͆t>zUy}BEGyEw%vٔ"_5I89+VV}ժ#zӄ"mË>L(X2,m(XMK{)ºscًkڃ~BS@^b}X;&`&PUIᄷX .e;IE:9'UP1\Ԛ*6XȚj2kuؖQ;B̰Ȟ݉S4H%WJ?N4dgH د[ X{t6?a,@.`N#Gk\T#E%"}k∍5wdtxpL:r6Ӂ gqْhI!|p  '~By2Uy c*ub)KjA2GCXc g``Yho[k+֩#yJkB F @0d:g[Ӛݾ1%%6cH%Q sVBshĻ@ +vySڎfC'yCV ȝ9#l iG&(-FLm.0j}0YiI(bDEcr3k%xG*aCf/zDhTGWKj}NZ w| ƍU7,R3k< QZ% 07Vw3sD,Vtsj~?Kc^dt<*Ȧ/(+{HAc?ɾBSX҄(͂;RW?팏|$ @1)7lY7@T~eKz3Y(H~!aޞvoE| L`? ล1~R+6Ė5MY%NdfAi|b7 5'p$rX1 ?p\Vޱְjw#fm[=C;53<Ê٧%At@4)c6J('S$Ȋfbp͋/$)U\~C(uʅ͋~Η1Akv<!~DȀn5kwdMX %"_EB8ߖ(.l,Ղ&O!a6_A_ei qB &[vjj4p]NT$\]~ $|E4O6nX+<&CeI`}ze^$&r?X\JpAC.I-B^)8n[87 4m I+LR o\f7jsGXܺ]Iʼ}rv)"(5gEF{ /@y2\d9ךp]E*oNqgGҍu_ɡ/8`x{cj,3o^s# Қ!e2$Y%?:PU59"IW'>~8ĝZ20Sn^k t r[s3؏SDgdFXi"],v ?ߵrHw#iҢEb>-ů9+X>w @~n?B-Z\z)Zσcn[RyuzRɩlna\nuALCj`{p~hϊ)B[!1SV‘c&]LĖGr^&u"M t͙ɕSj^:yL.+sX%#a`&+Jlr Ǔ];,l J\ *N U၌>zGW,tTDi۹wU -s1@@&߀$:$eje rGx2{FP4a5vu_mAY4fkX'\*} pxQi'lkk'O0UTO\iˤR7ʍoy,e- EIy 4+PKhrHL]i"cگR.K*M3ͪ&r$j jD_.B 2"Ц_E:EѬQ#9PaVV!NHX|p*PCZraOMl.XAJ)-r]^b΍|Ѓ+=qZON@lƯgbaNM¹JnŒ!~~q7[Ct얐amu.3>RƁk` n$-3 3QH)z\iMz]߃ Yz+ӌNsh cV, jʪb @|j%)R/z~{J«cY̆{AhtR_yS!nB|^UV+^#m=kwʳ΃M` vkqca,T-A4\RpZ][Z΢M5bbNn@?4V[Xz\H q.iP:Gkk1B4\$[|ĸV{lur#V<ȴĬ>MU~s|~sX)Ù-Nj`W_4u-Om61e]BB fnw B!Ruw2ap,HjJS{a-!R2X vRuR?%7 +iN=IK Eʼn{VKKaΌ;_>҇]# F37)ѱ{MPLv}MZg.v_ϫ^ؽSpR]̔p,IIwCBj9iٜ)iD+]=c*4/ƕ7]ɤH*r`8.Q̂KW#{< WR/Hu^Fכ%a~S)4 ',d 2y%I֦`ofmqt2ơ.7ekU 0W(BZ8}`6$!w0$e+סr(^Y5OQOrxxiW:-yu .Hnxφ`q(X۸I XvLʬ!u+{*Sؗ, G|W8BL]a- mP_d6?t6r0wJkB<{H5."9kXk;>ECEV`dau BV)6q@oC*x_  VZ|(,q%s gFll͓I^ ˏ)E+ c^3ڪE_Nt|RN$+xgݔe gToN-+ENY^$t[օ{vQрmPhlXg9fC$ۤ#qi=tt oh3)6h2o.:0J ?ECOH-7%t%u'Ql nOf2PyEQfĿ[)01$dPV2~.72q[0k}M=fJ͎q]j2uj.Vհ͘ Yl 2Wzcd9EFd)܃g6 -[搦̉+U9^Z.@&՟FJ |dJ}F*( &pYQCbuw<xB0^w[4bφܾAG]zF!hj{vdo@ѩ2f֛2B3m'OI^m05:0d>k"=:H/B ) vˍ7oCL ,gوlmw^ hA$(h`>e609qfWs Z O;Ҥ)0"*+W(+}..)' !ʳ0NJT,,Tdsء+7W=Z#e|xxX`GYg%es@G G Հ\ @*h`^PDZUES bg* /n;0R}'qbT$Ý͘<MZ1 |g|C8O1(ȡb©+O=zgۂULzz!0R(pvp&5@qBUocyJ =J`fS -rDsl,Ց"wi+T;LǫLJ=I\ KSuGp1^Mչ"zE;'&i3y型+/hʢ+|-*au* f$"d~̻\tFtD_˳^~ɮxUac 1JXD'@Ϸvj"ôZ"4 Ԝ}s'uɿXb~/ 6:",o|k% p„;q0%O؆|˲2'Rjk$s(ZZ8VtgCJ2lLFy$5IljN<"GzjZȔF~ :wRMHA2(ke4ʒk]զ4ǔؕQq2X+R h!ɐ$-%l"qUjGIfZDR^G`vbDD&=VoƅȰ}߆#h][VX!WD53EI~YhxB+616Cso$ (Q>j)nqşa1?Rj(u Uv 4meBn,0\,ڡwogP@@=yP,g#Mh2ObBUi» @9Qx@nc̄Z0+;.=b3ž6@4VHX P.ފbz0?ք*7Z8-ECn8C3MCFKmGe\(_ym{(D' _U|+{p6JGm_=-gά50,@5xSuNj5aJrp^:0x!)ZQTfϘZV_'J>fu'ut1 oXU7 e/~2?6Vavem9W?ݎcQܥ5>YfzOK<?mF:3԰8!hY5܌KoG%_GV&dd0oաe={;p ?WaKF愸_LaNA%=N/<ia,*g #JČYL~lDcO]q^ ԃ/F1kx.Pl+ %Nuˁ bkJrJ\׈w"g PEET Dn=tfiX`K MO+Nb:iEj"4~*xroc4@G6 #_qhcn+ ANjE L|(>IV]-X]A7&KQ.p5xJZ` Z腑 ø,<+E/7\OcI PB49%9'Ņ#J"~͂Šj\8f.2taF޸86q#irdV΅?ۆl])h;$2M뮔a,jIx15,UaoO<Ʊv= ˒BSKa%<>EO!aQU |E -u"5}xL8 Ka"x /YD&/(=+"kd#9rYuD`T K/­Ynƿc-҈bǜ8+CB\c\[Gz1h\ƪx$k4yC!8غq!-?W Ue. a`q:ϓ&.+[\yVܛs_\Ĕ|7Sox|]/ćy6sڟB ! bfR_Go}Q}Vc[ZBAܕo`y}BzP$GcF§\s|C~z2=F )j<ŁeQd}뗭 0zuX ߙ^OkǾp%z| 24HNa O |7+'a4/aq <gw Nym4j=퀉Asx T47P{/]/oLZTآHPXsl0OJ^)X>a#HW .00gAw& TȎ]n⊏~^]I%}R^t%D $6uk(Cy'dt DOsaQ 527<`9 n`1<[yUTCM:RtEre7hУO{Nqηfjz4a,麱Ftoߢ?_I<YS;vnۧ$5x/* Ea9s{ba9Vpllݦ5a{/.@ i.PLsU\&E\ˆo݇^pxh򻘉l&Reź橊 b$Wl0gC8 (:-„G%%!(BcWDJ1AH[D@7?eN8'@ dy?(*/x/ᱪx{)k{bi;5^oO Ik}?E&Cj~j.b`|05ڲ\/]I3" r҈7뺖C? p[AVYϠ^eK,_vJ}ܞ.g&|,w$/k,)%a,aS0޷{{-$" #Xtt?LV}nN.u詏oQDcu[ eۉ$ZfCl̯PYZẋ+C5h`Ϛ2xtKRs/\!L3\\:DNYPZ<"]\xOmi47pOaޱas+TYJG@;"KE8'pan <:m rТuxK)k%H տ[*ζ޳aSZ2if)n+#D^ΤMw=)\;uSM Qts=xEŭ@KfʈLdn8 ^. S))`k%-*K.1e*B g}#'z,#d[ -Spui!,Rt^zz}@*oo uTR,r@ӡؠa*E1ٺqK#n`G)^ mho-,bR?A^Sb͐Sg7Dk@PT8[F6[bM,ppKBK\?~juCK{ЏtUELҘS̅]|yP % 1=APfҋ/Uj(#6N:FF SpEuDɶ_9U|OsU/wĆ w'Ylp|Yy#`5DK\Y;!z=YvQuZ៷ctz̹ ?\EGyhSGX?*Rpϵ0NO^67x(Ȯ u+cXړթz~.zx 7X)::XJ<|μ `8[w՛R߼i5wrYW~~>PP!]դ5E^ (h|vLT#j'`rlU*7V2N|l.ilFxPATmGe6 \ tBz=t`F .I>>8 l } Ow k{} |}"?<B+T]ZxDVpHL<ӵOjڧEMra)Q?D] gCҫFrozk6 poޱ2i l13դkLż.=?NfAf1o{VTd銻Ąﰴg%Pmɶ"[G;ӄ0+5ՒKo9cpoC 5t@>@WZ98mMNSORU-^WR+U' *R&Cqr4UL b:#eb>= 'ۊ7A._.Xa;@[?bhgS(qz\3y" n8@Z٦-%6 {֠<Rc<2쐙f6{eq7sT%zwM/h*zGte@ko`A%3o*ikq2_s[y9C<' qsY?)_ѧBϼċwJc64bDe]e~654 9[\A~up*ܫ&g }ȁ`.l+U knuHW"Sjp[m|qܢ(R_\b`X(2?U!<{CP+^2G%sfa2r'´" C%_`tZs?p\Tv #_4f) yYNH5IkKϱZ (Yu߫I{ἓ,0_RVԢc5{(4@ĬHw&tj+LMge0 R~jRx9>]&]LE)?a{ȣ u }.쟎RȞ|!gl}Ne3OaN-T+ ^5Cļ&pq/vdaϗv(ʮ0R0,a `7f }FT֛$#}UNp, Ed.zv3gv;q2 h/eSF3p!;{!q3R7uM!Ԃ&Zs`ˤOߙ;?ZS(ٟd &tMRv >XPi4TQ,vh+(+cB|`1MZDxj"ĉV[(ɓ9$}:#ꁤD?[PK&TՉy3. }͜VwΈqsP9ۓr/I'^(U]Bsv@ɜ>!wN*LCuKf炴?E>SmqsqKt" {w#^ǤUbORE'2J[xF1L7 Ln1$ T)`y>5Ξ c YZ