gvim-9.1.0836-150500.20.15.1<>, dgQp9|6 $uxOdzL[UD "ʶ27;u is not decoded to literal Escape in kitty/foot * 9.1.0787: cursor position changed when using hidden terminal * 9.1.0786: tests: quickfix update test does not test location list * runtime(doc): add some docs for file-watcher programs * CI: uploading failed screendumps still fails on Cirrus CI * 9.1.0785: cannot preserve error position when setting quickfix list * 9.1.0784: there are several problems with python 3.13 * 9.1.0783: 'spell' option setting has problems * 9.1.0782: tests: using wrong neomuttlog file name * runtime(doc): add preview flag to statusline example * 9.1.0781: tests: test_filetype fails * 9.1.0780: MS-Windows: incorrect Win32 error checking * 9.1.0779: filetype: neomuttlog files are not recognized * 9.1.0778: filetype: lf config files are not recognized * runtime(comment): fix commment toggle with mixed tabs & spaces * runtime(misc): Use consistent "Vim script" spelling * runtime(gleam): add ftplugin for gleam files * runtime(doc): link help-writing from write-local-help * 9.1.0777: filetype: Some upstream php files are not recognized * runtime(java): Define javaBlockStart and javaBlockOtherStart hl groups * runtime(doc): mention conversion rules for remote_expr() * runtime(tutor): Fix missing :s command in spanish translation section 4.4 * 9.1.0776: test_strftime may fail because of missing TZ data * translation(am): Add Armenian language translation * 9.1.0775: tests: not enough tests for setting options * 9.1.0774: "shellcmdline" doesn't work with getcompletion() * 9.1.0773: filetype: some Apache files are not recognized * 9.1.0772: some missing changes from v9.1.0771 * 9.1.0771: completion attribute hl_group is confusing * 9.1.0770: current command line completion is a bit limited * 9.1.0769: filetype: MLIR files are not recognized * 9.1.0768: MS-Windows: incorrect cursor position when restoring screen * runtime(nasm): Update nasm syntax script * 9.1.0767: A condition is always true in ex_getln.c * runtime(skill): Update syntax file to fix string escapes * runtime(help): highlight CTRL- correctly * runtime(doc): add missing usr_52 entry to toc * 9.1.0766: too many strlen() calls in ex_getln.c * runtime(doc): correct `vi` registers 1-9 documentation error * 9.1.0765: No test for patches 6.2.418 and 7.3.489 * runtime(spec): set comments and commentstring options * NSIS: Include libgcc_s_sjlj-1.dll again * runtime(doc): clarify the effect of 'startofline' option * 9.1.0764: [security]: use-after-free when closing a buffer * runtime(vim): Update base-syntax file, improve class, enum and interface highlighting * 9.1.0763: tests: cannot run single syntax tests * 9.1.0762: 'cedit', 'termwinkey' and 'wildchar' may not be parsed correctly * 9.1.0761: :cd completion fails on Windows with backslash in path * 9.1.0760: tests: no error reported, if gen_opt_test.vim fails * 9.1.0759: screenpos() may return invalid position * runtime(misc): unset compiler in various ftplugins * runtime(doc): update formatting and syntax * runtime(compiler): add cppcheck linter compiler plugin * runtime(doc): Fix style in documents * runtime(doc): Fix to two-space convention in user manual * runtime(comment): consider &tabstop in lines after whitespace indent * 9.1.0758: it's possible to set an invalid key to 'wildcharm' * runtime(java): Manage circularity for every :syn-included syntax file * 9.1.0757: tests: messages files contains ANSI escape sequences * 9.1.0756: missing change from patch v9.1.0754 * 9.1.0755: quickfix list does not handle hardlinks well * runtime(doc): 'filetype', 'syntax' and 'keymap' only allow alphanumeric + some characters * runtime(systemd): small fixes to &keywordprg in ftplugin * CI: macos-12 runner is being sunset, switch to 13 * 9.1.0754: fixed order of items in insert-mode completion menu * runtime(comment): commenting might be off by one column * 9.1.0753: Wrong display when typing in diff mode with 'smoothscroll' * 9.1.0752: can set 'cedit' to an invalid value * runtime(doc): add `usr` tag to usr_toc.txt * 9.1.0751: Error callback for term_start() not used * 9.1.0750: there are some Win9x legacy references * runtime(java): Recognise the CommonMark form (///) of Javadoc comments * 9.1.0749: filetype: http files not recognized * runtime(comment): fix syntax error * CI: uploading failed screendump tests does not work Cirrus * 9.1.0748: :keep* commmands are sometimes misidentified as :k * runtime(indent): allow matching negative numbers for gnu indent config file * runtime(comment): add gC mapping to (un)comment rest of line * 9.1.0747: various typos in repo found * 9.1.0746: tests: Test_halfpage_longline() fails on large terminals * runtime(doc): reformat gnat example * runtime(doc): reformat ada_standard_types section * 9.1.0745: filetype: bun and deno history files not recognized * runtime(glvs): Correct the tag name of glvs-autoinstal * runtime(doc): include short form for :earlier/:later * runtime(doc): remove completed TODO * 9.1.0744: filetype: notmuch configs are not recognised * 9.1.0743: diff mode does not handle overlapping diffs correctly * runtime(glvs): fix a few issues * runtime(doc): Fix typo in :help :command-modifiers * 9.1.0742: getcmdprompt() implementation can be improved * runtime(docs): update `:set?` command behavior table * runtime(doc): update vim90 to vim91 in docs * runtime(doc): fix typo in :h dos-colors * 9.1.0741: No way to get prompt for input()/confirm() * runtime(doc): fix typo in version9.txt nrformat -> nrformats * runtime(rmd,rrst): 'fex' option not properly restored * runtime(netrw): remove extraneous closing bracket * 9.1.0740: incorrect internal diff with empty file * 9.1.0739: [security]: use-after-free in ex_getln.c * runtime(filetype): tests: Test_filetype_detection() fails * runtime(dist): do not output a message if executable is not found * 9.1.0738: filetype: rapid files are not recognized * runtime(modconf): remove erroneous :endif in ftplugin * runtime(lyrics): support multiple timestamps in syntax script * runtime(java): Optionally recognise _module_ import declarations * runtime(vim): Update base-syntax, improve folding function matches * CI: upload failed screendump tests also for Cirrus * 9.1.0737: tests: screendump tests may require a bit more time * runtime(misc): simplify keywordprg in various ftplugins * runtime(java): Optionally recognise all primitive constants in _switch-case_ labels * runtime(zsh,sh): set and unset compiler in ftplugin * runtime(netrw): using inefficient highlight pattern for 'mf' * 9.1.0736: Unicode tables are outdated * 9.1.0735: filetype: salt files are not recognized * 9.1.0734: filetype: jinja files are not recognized * runtime(zathurarc): add double-click-follow to syntax script * translation(ru): Updated messages translation * translation(it): updated xxd man page * translation(ru): updated xxd man page * 9.1.0733: keyword completion does not work with fuzzy * 9.1.0732: xxd: cannot use -b and -i together * runtime(java): Highlight javaConceptKind modifiers with StorageClass * runtime(doc): reword and reformat how to use defaults.vim * 9.1.0731: inconsistent case sensitive extension matching * runtime(vim): Update base-syntax, match Vim9 bool/null literal args to :if/:while/:return * runtime(netrw): delete confirmation not strict enough * 9.1.0730: Crash with cursor-screenline and narrow window * 9.1.0729: Wrong cursor-screenline when resizing window * 9.1.0728: [security]: heap-use-after-free in garbage collection with location list user data * runtime(doc): clarify the effect of the timeout for search()-functions * runtime(idlang): update syntax script * runtime(spec): Recognize epoch when making spec changelog in ftplugin * runtime(spec): add file triggers to syntax script * 9.1.0727: too many strlen() calls in option.c * runtime(make): add compiler/make.vim to reset compiler plugin settings * runtime(java): Recognise all available standard doclet tags * 9.1.0726: not using correct python3 API with dynamic linking * runtime(dosini): Update syntax script, spellcheck comments only * runtime(doc): Revert outdated comment in completeopt's fuzzy documentation * 9.1.0725: filetype: swiftinterface files are not recognized * runtime(pandoc): Update compiler plugin to use actual 'spelllang' * runtime(groff): Add compiler plugin for groff * 9.1.0724: if_python: link error with python 3.13 and stable ABI * 9.1.0723: if_python: dynamic linking fails with python3 >= 3.13 * 9.1.0722: crash with large id in text_prop interface * 9.1.0721: tests: test_mksession does not consider XDG_CONFIG_HOME * runtime(glvs): update GetLatestVimScripts plugin * runtime(doc): Fix typo in :help :hide text * runtime(doc): buffers can be re-used * 9.1.0720: Wrong breakindentopt=list:-1 with multibyte or TABs * 9.1.0719: Resetting cell widths can make 'listchars' or 'fillchars' invalid * runtime(doc): Update version9.txt and mention $MYVIMDIR - Update to 9.1.0718: * v9.1.0718: hard to know the users personal Vim Runtime Directory * v9.1.0717: Unnecessary nextcmd NULL checks in parse_command_modifiers() Maintainers: fix typo in author name * v9.1.0716: resetting setcellwidth( doesn't update the screen runtime(hcl,terraform): Add runtime files for HCL and Terraform runtime(tmux): Update syntax script * v9.1.0715: Not correctly parsing color names (after v9.1.0709) * v9.1.0714: GuiEnter_Turkish test may fail * v9.1.0713: Newline causes E749 in Ex mode * v9.1.0712: missing dependency of Test_gettext_makefile * v9.1.0711: test_xxd may file when using different xxd * v9.1.0710: popup window may hide part of Command line runtime(vim): Update syntax, improve user-command matching * v9.1.0709: GUIEnter event not found in Turkish locale runtime(sudoers): improve recognized Runas_Spec and Tag_Spec items * v9.1.0708: Recursive window update does not account for reset skipcol runtime(nu): include filetype plugin * v9.1.0707: invalid cursor position may cause a crash * v9.1.0706: test_gettext fails when using shadow dir CI: Install locales-all package * v9.1.0705: Sorting of fuzzy filename completion is not stable translation(pt): update Portuguese/Brazilian menu translation runtime(vim): Update base-syntax, match bracket mark ranges runtime(doc): Update :help :command-complete list * v9.1.0704: inserting with a count is inefficient runtime(doc): use mkdir -p to save a command * v9.1.0703: crash with 2byte encoding and glob2regpat() runtime(hollywood): update syn highlight for If-Then statements and For-In-Loops * v9.1.0702: Patch 9.1.0700 broke CI * v9.1.0701: crash with NFA regex engine when searching for composing chars * v9.1.0700: crash with 2byte encoding and glob2regpat() * v9.1.0699: "dvgo" is not always an inclusive motion runtime(java): Provide support for syntax preview features * v9.1.0698: "Untitled" file not removed when running Test_crash1_3 alone * v9.1.0697: heap-buffer-overflow in ins_typebuf * v9.1.0696: installing runtime files fails when using SHADOWDIR runtime(doc): fix typo * v9.1.0695: test_crash leaves Untitled file around translation(br): Update Brazilian translation translation(pt): Update menu_pt_br * v9.1.0694: matchparen is slow on a long line * v9.1.0693: Configure doesn't show result when not using python3 stable abi * v9.1.0692: Wrong patlen value in ex_substitute() * v9.1.0691: stable-abi may cause segfault on Python 3.11 runtime(vim): Update base-syntax, match :loadkeymap after colon and bar runtime(mane): Improve ManBS mapping * v9.1.0690: cannot set special highlight kind in popupmenu translation(pt): Revert and fix wrong Portuguese menu translation files translation(pt): revert Portuguese menu translation translation(br): Update Brazilian translations runtime(vim): Update base-syntax, improve :let-heredoc highlighting * v9.1.0689: buffer-overflow in do_search( with 'rightleft' runtime(vim): Improve heredoc handling for all embedded scripts * v9.1.0688: dereferences NULL pointer in check_type_is_value() * v9.1.0687: Makefile may not install desktop files runtime(man): Fix ManBS runtime(java): Make the bundled &foldtext function optional runtime(netrw): Change line on `mx` if command output exists runtime(netrw): Fix `mf`-selected entry highlighting runtime(htmlangular): add html syntax highlighting translation(it): Fix filemode of Italian manpages runtime(doc): Update outdated man.vim plugin information runtime(zip): simplify condition to detect MS-Windows * v9.1.0686: zip-plugin has problems with special characters runtime(pandoc): escape quotes in &errorformat for pandoc translation(it): updated Italian manpage * v9.1.0685: too many strlen( calls in usercmd.c runtime(doc): fix grammar in :h :keeppatterns runtime(pandoc): refine pandoc compiler settings * v9.1.0684: completion is inserted on Enter with "noselect" translation(ru): update man pages * v9.1.0683: mode( returns wrong value with mapping runtime(doc): remove trailing whitespace in cmdline.txt * v9.1.0682: Segfault with uninitialized funcref * v9.1.0681: Analyzing failed screendumps is hard runtime(doc): more clarification for the :keeppatterns needed * v9.1.0680: VMS does not have defined uintptr_t runtime(doc): improve typedchar documentation for KeyInputPre autocmd runtime(dist): verify that executable is in $PATH translation(it): update Italian manpages runtime(doc): clarify the effect of :keeppatterns after * v9.1.0677 runtime(doc): update Makefile and make it portable between GNU and BSD * v9.1.0679: Rename from w_closing to w_locked is incomplete runtime(colors): update colorschemes runtime(vim): Update base-syntax, improve :let-heredoc highlighting runtime(doc): Updating the examples in the xxd manpage translation(ru): Updated uganda.rux runtime(yaml): do not re-indent when commenting out lines * v9.1.0678: use-after-free in alist_add() * v9.1.0677 :keepp does not retain the substitute pattern translation(ja): Update Japanese translations to latest release runtime(netrw): Drop committed trace lines runtime(netrw): Error popup not always used runtime(netrw): ErrorMsg( may throw E121 runtime(tutor): update Makefile and make it portable between GNU and BSD translation: improve the po/cleanup.vim script runtime(lang): update Makefile and make it portable between GNU and BSD * v9.1.0676: style issues with man pages * v9.1.0675: Patch v9.1.0674 causes problems runtime(dosbatch): Show %%i as an argument in syntax file runtime(dosbatch): Add syn-sync to syntax file runtime(sql, mysql): fix E169: Command too recursive with sql_type_default = "mysql" * v9.1.0674: compiling abstract method fails because of missing return runtime(javascript): fix a few issues with syntax higlighting runtime(mediawiki): fix typo in doc, test for b:did_ftplugin var runtime(termdebug): Fix wrong test for balloon feature runtime(doc): Remove mentioning of the voting feature runtime(doc): add help tags for json + markdown global variables * v9.1.0673: too recursive func calls when calling super-class method runtime(syntax-tests): Facilitate the viewing of rendered screendumps runtime(doc): fix a few style issues * v9.1.0672: marker folds may get corrupted on undo * v9.1.0671 Problem: crash with WinNewPre autocommand * v9.1.0670: po file encoding fails on *BSD during make translation(it): Update Italian translation translation: Stop using msgconv * v9.1.0669: stable python ABI not used by default Update .gitignore and .hgignore files * v9.1.0668: build-error with python3.12 and stable ABI translations: Update generated po files * v9.1.0667: Some other options reset curswant unnecessarily when set * v9.1.0666: assert_equal( doesn't show multibyte string correctly runtime(doc): clarify directory of Vim's executable vs CWD * v9.1.0665 :for loop runtime(proto): Add indent script for protobuf filetype * v9.1.0664: console vim did not switch back to main screen on exit runtime(zip): zip plugin does not work with Vim 9.0 * v9.1.0663: zip test still resets 'shellslash' option runtime(zip): use defer to restore old settings runtime(zip): add a generic Message function runtime(zip): increment base version of zip plugin runtime(zip): raise minimum Vim version to * v9.0 runtime(zip): refactor save and restore of options runtime(zip): remove test for fnameescape runtime(zip): use :echomsg instead of :echo runtime(zip): clean up and remove comments * v9.1.0662: filecopy( may return wrong value when readlink( fails * v9.1.0661: the zip plugin is not tested. runtime(zip): Fix for FreeBSD's unzip command runtime(doc): capitalize correctly * v9.1.0660: Shift-Insert does work on old conhost translation(it): update Italian manpage runtime(lua): add/subtract a 'shiftwidth' after '('/')' in indentexpr runtime(zip): escape '[' on Unix as well * v9.1.0659: MSVC Makefile is a bit hard to read runtime(doc): fix typo in syntax.txt runtime(doc): -x is only available when compiled with crypt feature * v9.1.0658: Coverity warns about dereferencing NULL pointer. runtime(colors): update Todo highlight in habamax colorscheme * v9.1.0657: MSVC build time can be optimized * v9.1.0656: MSVC Makefile CPU handling can be improved * v9.1.0655: goaccess config file not recognized CI: update clang compiler to version 20 runtime(netrw): honor `g:netrw_alt{o,v}` for `:{S,H,V}explore` * v9.1.0654: completion does not respect completeslash with fuzzy * v9.1.0653: Patch v9.1.0648 not completely right * v9.1.0652: too many strlen( calls in syntax.c * v9.1.0651 :append * v9.1.0650: Coverity warning in cstrncmp() * v9.1.0649: Wrong comment for "len" argument of call_simple_func() * v9.1.0648: [security] double-free in dialog_changed() * v9.1.0647: [security] use-after-free in tagstack_clear_entry runtime(doc): re-format tag example lines, mention ctags --list-kinds * v9.1.0646: imported function may not be found runtime(java): Document "g:java_space_errors" and "g:java_comment_strings" runtime(java): Cluster optional group definitions and their group links runtime(java): Tidy up the syntax file runtime(java): Tidy up the documentation for "ft-java-syntax" runtime(colors): update habamax scheme - tweak diff/search/todo colors runtime(nohlsearch): add missing loaded_hlsearch guard runtime(kivy): Updated maintainer info for syntax script Maintainers: Add maintainer for ondir ftplugin + syntax files runtime(netrw): removing trailing slash when copying files in same directory * v9.1.0645: wrong match when searching multi-byte char case-insensitive runtime(html): update syntax script to sync by 250 minlines by default * v9.1.0644: Unnecessary STRLEN( when applying mapping runtime(zip): Opening a remote zipfile don't work runtime(cuda): source c and cpp ftplugins * v9.1.0643: cursor may end up on invalid position * v9.1.0642: Check that mapping rhs starts with lhs fails if not simplified * v9.1.0641: OLE enabled in console version runtime(thrift): add ftplugin, indent and syntax scripts * v9.1.0640: Makefile can be improved * v9.1.0639: channel timeout may wrap around * v9.1.0638: E1510 may happen when formatting a message for smsg() * v9.1.0637: Style issues in MSVC Makefile - Update apparmor.vim to latest version (from AppArmor 4.0.2) - add support for "all" and "userns" rules, and new profile flags - Update to 9.1.0636: * 9.1.0636: filetype: ziggy files are not recognized * 9.1.0635: filetype: SuperHTML template files not recognized * 9.1.0634: Ctrl-P not working by default * 9.1.0633: Compilation warnings with `-Wunused-parameter` * 9.1.0632: MS-Windows: Compiler Warnings Add support for Files-Included in syntax script tweak documentation style a bit * 9.1.0631: wrong completion list displayed with non-existing dir + fuzzy completion * 9.1.0630: MS-Windows: build fails with VIMDLL and mzscheme * 9.1.0629: Rename of pum hl_group is incomplete * 9.1.0628: MinGW: coverage files are not cleaned up * 9.1.0627: MinGW: build-error when COVERAGE is enabled * 9.1.0626: Vim9: need more tests with null objects include initial filetype plugin * 9.1.0625: tests: test output all translated messages for all translations * 9.1.0624: ex command modifiers not found * 9.1.0623: Mingw: errors when trying to delete non-existing files * 9.1.0622: MS-Windows: mingw-build can be optimized * 9.1.0621: MS-Windows: startup code can be improved * 9.1.0620: Vim9: segfauls with null objects * 9.1.0619: tests: test_popup fails * 9.1.0618: cannot mark deprecated attributes in completion menu * 9.1.0617: Cursor moves beyond first line of folded end of buffer * 9.1.0616: filetype: Make syntax highlighting off for MS Makefiles * 9.1.0615: Unnecessary STRLEN() in make_percent_swname() Add single-line comment syntax Add syntax test for comments Update maintainer info * 9.1.0614: tests: screendump tests fail due to recent syntax changes * 9.1.0613: tests: termdebug test may fail and leave file around Update base-syntax, improve :set highlighting Optionally highlight the :: token for method references * 9.1.0612: filetype: deno.lock file not recognized Use delete() for deleting directory escape filename before trying to delete it * 9.1.0611: ambiguous mappings not correctly resolved with modifyOtherKeys correctly extract file from zip browser * 9.1.0610: filetype: OpenGL Shading Language files are not detected Fix endless recursion in netrw#Explore() * 9.1.0609: outdated comments in Makefile update syntax script Fix flow mapping key detection Remove orphaned YAML syntax dump files * 9.1.0608: Coverity warns about a few potential issues Update syntax script and remove syn sync * 9.1.0607: termdebug: uses inconsistent style * 9.1.0606: tests: generated files may cause failure in test_codestyle * 9.1.0605: internal error with fuzzy completion * 9.1.0604: popup_filter during Press Enter prompt seems to hang translation: Update Serbian messages translation * 9.1.0603: filetype: use correct extension for Dracula * 9.1.0602: filetype: Prolog detection can be improved fix more inconsistencies in assert function docs * 9.1.0601: Wrong cursor position with 'breakindent' when wide char doesn't fit Update base-syntax, improve :map highlighting * 9.1.0600: Unused function and unused error constants * 9.1.0599: Termdebug: still get E1023 when specifying arguments correct wrong comment options fix typo "a xterm" -> "an xterm" * 9.1.0598: fuzzy completion does not work with default completion * 9.1.0597: KeyInputPre cannot get the (unmapped typed) key * 9.1.0596: filetype: devscripts config files are not recognized gdb file/folder check is now performed only in CWD. quote filename arguments using double quotes update syntax to SDC-standard 2.1 minor updates. Cleanup :match and :loadkeymap syntax test files Update base-syntax, match types in Vim9 variable declarations * 9.1.0595: make errors out with the po Makefile * 9.1.0594: Unnecessary redraw when setting 'winfixbuf' using wrong highlight for UTF-8 include simple syntax plugin * 9.1.0593: filetype: Asymptote files are not recognized add recommended indent options to ftplugin add recommended indent options to ftplugin add recommended indent options to ftplugin * 9.1.0592: filetype: Mediawiki files are not recognized * 9.1.0591: filetype: *.wl files are not recognized * 9.1.0590: Vim9: crash when accessing getregionpos() return value 'cpoptions': Include "z" in the documented default * 9.1.0589: vi: d{motion} and cw work differently than expected update included colorschemes grammar fixes in options.txt - Add "Keywords" to gvim.desktop to make searching for gvim easier - Removed patches, as they're no longer required (refreshing them deleted their contents): * vim-7.3-help_tags.patch * vim-7.4-highlight_fstab.patch - Reorganise all applied patches in the spec file. - Update to 9.1.0588: * 9.1.0588: The maze program no longer compiles on newer clang runtime(typst): Add typst runtime files * 9.1.0587: tests: Test_gui_lowlevel_keyevent is still flaky * 9.1.0586: ocaml runtime files are outdated runtime(termdebug): fix a few issues * 9.1.0585: tests: test_cpoptions leaves swapfiles around * 9.1.0584: Warning about redeclaring f_id() non-static runtime(doc): Add hint how to load termdebug from vimrc runtime(doc): document global insert behavior * 9.1.0583: filetype: *.pdf_tex files are not recognized * 9.1.0582: Printed line doesn't overwrite colon when pressing Enter in Ex mode * 9.1.0581: Various lines are indented inconsistently * 9.1.0580: :lmap mapping for keypad key not applied when typed in Select mode * 9.1.0579: Ex command is still executed after giving E1247 * 9.1.0578: no tests for :Tohtml * 9.1.0577: Unnecessary checks for v:sizeoflong in test_put.vim * 9.1.0576: tests: still an issue with test_gettext_make * 9.1.0575: Wrong comments in alt_tabpage() * 9.1.0574: ex: wrong handling of commands after bar runtime(doc): add a note for netrw bug reports * 9.1.0573: ex: no implicit print for single addresses runtime(vim): make &indentexpr available from the outside * 9.1.0572: cannot specify tab page closing behaviour runtime(doc): remove obsolete Ex insert behavior * 9.1.0571: tests: Test_gui_lowlevel_keyevent is flaky runtime(logindefs): update syntax with new keywords * 9.1.0570: tests: test_gettext_make can be improved runtime(filetype): Fix Prolog file detection regex * 9.1.0569: fnamemodify() treats ".." and "../" differently runtime(mojo): include mojo ftplugin and indent script * 9.1.0568: Cannot expand paths from 'cdpath' setting * 9.1.0567: Cannot use relative paths as findfile() stop directories * 9.1.0566: Stop dir in findfile() doesn't work properly w/o trailing slash * 9.1.0565: Stop directory doesn't work properly in 'tags' * 9.1.0564: id() can be faster * 9.1.0563: Cannot process any Key event * 9.1.0562: tests: inconsistency in test_findfile.vim runtime(fstab): Add missing keywords to fstab syntax * 9.1.0561: netbeans: variable used un-initialized (Coverity) * 9.1.0560: bindtextdomain() does not indicate an error * 9.1.0559: translation of vim scripts can be improved * 9.1.0558: filetype: prolog detection can be improved * 9.1.0557: moving in the buffer list doesn't work as documented runtime(doc): fix inconsistencies in :h file-searching * 9.1.0556: :bwipe doesn't remove file from jumplist of other tabpages runtime(htmlangular): correct comment * 9.1.0555: filetype: angular ft detection is still problematic * 9.1.0554: :bw leaves jumplist and tagstack data around * 9.1.0553: filetype: *.mcmeta files are not recognized * 9.1.0552: No test for antlr4 filetype * 9.1.0551: filetype: htmlangular files are not properly detected * 9.1.0550: filetype: antlr4 files are not recognized * 9.1.0549: fuzzycollect regex based completion not working as expected runtime(doc): autocmd_add() accepts a list not a dict * 9.1.0548: it's not possible to get a unique id for some vars runtime(tmux): Update syntax script * 9.1.0547: No way to get the arity of a Vim function * 9.1.0546: vim-tiny fails on CTRL-X/CTRL-A runtime(hlsplaylist): include hlsplaylist ftplugin file runtime(doc): fix typo in :h ft-csv-syntax runtime(doc): Correct shell command to get $VIMRUNTIME into shell * 9.1.0545: MSVC conversion warning * 9.1.0544: filetype: ldapconf files are not recognized runtime(cmakecache): include cmakecache ftplugin file runtime(lex): include lex ftplugin file runtime(yacc): include yacc ftplugin file runtime(squirrel): include squirrel ftplugin file runtime(objcpp): include objcpp ftplugin file runtime(tf): include tf ftplugin file runtime(mysql): include mysql ftplugin file runtime(javacc): include javacc ftplugin file runtime(cabal): include cabal ftplugin file runtime(cuda): include CUDA ftplugin file runtime(editorconfig): include editorconfig ftplugin file runtime(kivy): update kivy syntax, include ftplugin runtime(syntax-tests): Stop generating redundant "*_* 99.dump" files * 9.1.0543: Behavior of CursorMovedC is strange runtime(vim): Update base-syntax, improve :match command highlighting * 9.1.0542: Vim9: confusing string() output for object functions * 9.1.0541: failing test with Vim configured without channel * 9.1.0540: Unused assignment in sign_define_cmd() runtime(doc): add page-scrolling keys to index.txt runtime(doc): add reference to xterm-focus-event from FocusGained/Lost * 9.1.0539: Not enough tests for what v9.1.0535 fixed runtime(doc): clarify how to re-init csv syntax file * 9.1.0538: not possible to assign priority when defining a sign * 9.1.0537: signed number detection for CTRL-X/A can be improved * 9.1.0536: filetype: zone files are not recognized * 9.1.0535: newline escape wrong in ex mode runtime(man): honor cmd modifiers before `g:ft_man_open_mode` runtime(man): use `nnoremap` to map to Ex commands * 9.1.0534: completion wrong with fuzzy when cycling back to original runtime(syntax-tests): Abort and report failed cursor progress runtime(syntax-tests): Introduce self tests for screen dumping runtime(syntax-tests): Clear and redraw the ruler line with the shell info runtime(syntax-tests): Allow for folded and wrapped lines in syntax test files * 9.1.0533: Vim9: need more tests for nested objects equality CI: Pre-v* 9.0.0110 versions generate bogus documentation tag entries runtime(doc): Remove wrong help tag CTRL-SHIFT-CR * 9.1.0532: filetype: Cedar files not recognized runtime(doc): document further keys that scroll page up/down * 9.1.0531: resource leak in mch_get_random() runtime(tutor): Fix wrong spanish translation runtime(netrw): fix remaining case of register clobber * 9.1.0530: xxd: MSVC warning about non-ASCII character * 9.1.0529: silent! causes following try/catch to not work runtime(rust): use shiftwidth() in indent script * 9.1.0528: spell completion message still wrong in translations * 9.1.0527: inconsistent parameter in Makefiles for Vim executable * 9.1.0526: Unwanted cursor movement with pagescroll at start of buffer runtime(doc): mention $XDG_CONFIG_HOME instead of $HOME/.config * 9.1.0525: Right release selects immediately when pum is truncated. * 9.1.0524: the recursive parameter in the *_equal functions can be removed runtime(termdebug): Add Deprecation warnings * 9.1.0523: Vim9: cannot downcast an object * 9.1.0522: Vim9: string(object) hangs for recursive references * 9.1.0521: if_py: _PyObject_CallFunction_SizeT is dropped in Python 3.13 * 9.1.0520: Vim9: incorrect type checking for modifying lists runtime(manpager): avoid readonly prompt * 9.1.0519: MS-Windows: libvterm compilation can be optimized * 9.1.0518: initialize the random buffer can be improved * 9.1.0517: MS-Windows: too long lines in Make_mvc.mak runtime(terraform): Add filetype plugin for terraform runtime(dockerfile): enable spellchecking of comments in syntax script runtime(doc): rename variable for pandoc markdown support runtime(doc): In builtin overview use {buf} as param for appendbufline/setbufline runtime(doc): clarify, that register 1-* 9 will always be shifted runtime(netrw): save and restore register 0-* 9, a and unnamed runtime(termdebug): Refactored StartDebug_term and EndDebug functions runtime(java): Compose "g:java_highlight_signature" and "g:java_highlight_functions" * 9.1.0516: need more tests for nested dicts and list comparision * 9.1.0515: Vim9: segfault in object_equal() * 9.1.0514: Vim9: issue with comparing objects recursively runtime(termdebug): Change some variables to Enums runtime(vim): Update base-syntax, fix function tail comments * 9.1.0513: Vim9: segfault with object comparison - Update to 9.1.0512: * Mode message for spell completion doesn't match allowed keys * CursorMovedC triggered wrongly with setcmdpos() * update runtime files * CI: test_gettext fails on MacOS14 + MSVC Win * not possible to translate Vim script messages * termdebug plugin can be further improved * add gomod filetype plugin * hard to detect cursor movement in the command line * Optionally highlight parameterised types * filetype: .envrc & .prettierignore not recognized * filetype: Faust files are not recognized * inner-tag textobject confused about ">" in attributes * cannot use fuzzy keyword completion * Remove the group exclusion list from @javaTop * wrong return type for execute() function * MS-Windows: too much legacy code * too complicated mapping restore in termdebug * simplify mapping * cannot switch buffer in a popup * MS-Windows: doesn't handle symlinks properly * getcmdcompltype() interferes with cmdline completion * termdebug can be further improved * update htmldjango detection * Improve Turkish documentation * include a simple csv filetype and syntax plugin * include the the simple nohlsearch package * matched text is highlighted case-sensitively * Matched text isn't highlighted in cmdline pum * Fix typos in several documents * clarify when text properties are cleared * improve the vim-shebang example * revert unintended formatting changes for termdebug * Add a config variable for commonly used compiler options * Wrong matched text highlighted in pum with 'rightleft' * bump length of character references in syntax script * properly check mapping variables using null_dict * fix KdlIndent and kdlComment in indent script * Test for patch 9.1.0489 doesn't fail without the fix * Fold multi-line comments with the syntax kind of &fdm * using wrong type for PlaceSign() * filetype: Vim-script files not detected by shebang line * revert unintended change to zip#Write() * add another tag for vim-shebang feature * Cmdline pum doesn't work properly with 'rightleft' * minor style problems with patch 9.1.0487 * default completion may break with fuzzy * Wrong padding for pum "kind" with 'rightleft' * Update base-syntax, match shebang lines * MS-Windows: handle files with spaces properly * Restore HTML syntax file tests * completed item not update on fuzzy completion * filetype: Snakemake files are not recognized * make TermDebugSendCommand() a global function again * close all buffers in the same way * Matched text shouldn't be highlighted in "kind" and "menu" * fix wrong helptag for :defer * Update base-syntax, match :sleep arg * include Georgian keymap * Sorting of completeopt+=fuzzy is not stable * correctly test for windows in NetrwGlob() * glob() on windows fails with [] in directory name * rewrite mkdir() doc and simplify {flags} meaning * glob() not sufficiently tested * update return type for job_info() * termdebug plugin needs more love * correct return types for job_start() and job_status() * Update base-syntax, match :catch and :throw args * Include element values in non-marker annotations * Vim9: term_getjob() throws an exception on error * fuzzy string matching executed when not needed * fuzzy_match_str_with_pos() does unnecessary list operations * restore description of "$" in col() and virtcol() * deduplicate getpos(), line(), col(), virtcol() * Update g:vimsyn_comment_strings dump file tests * Use string interpolation instead of string concat * potential deref of NULL pointer in fuzzy_match_str_with_pos * block_editing errors out when using * Update base-syntax, configurable comment string highlighting * fix typos in syntax.txt * Cannot see matched text in popup menu * Update base-syntax, match multiline continued comments * clarify documentation for "v" position at line() * cmod_split modifier is always reset in term_start() * remove line-continuation characters * use shiftwidth() instead of &tabstop in indent script * Remove orphaned screen dump files * include syntax, indent and ftplugin files * CI: Test_ColonEight() fails on github runners * add missing Enabled field in syntax script * basic svelte ftplugin file * term_start() does not clear vertical modifier * fix mousemodel restoration by comparing against null_string * Added definitions of Vim scripts and plugins * Exclude lambda expressions from _when_ _switch-case_ label clauses * Fix saved_mousemodel check * Inconsistencies between functions for option flags * Crash when using autocmd_get() after removing event inside autocmd * Fix small style issues * add return type info for Vim function descriptions * Update Italian Vim manpage * disable the q mapping * Change 'cms' for C++ to '// %s' * fix type mismatch error * Fix wrong email address * convert termdebug plugin to Vim9 script - Update to 9.1.0470: * tests Test_ColonEight_MultiByte() fails sporadically * Cannot have buffer-local value for 'completeopt' * GvimExt does not consult HKEY_CURRENT_USER * typos in some comments * runtime(vim): Update base-syntax, allow whitespace before :substitute pattern * Missing comments for fuzzy completion * runtime(man): update Vim manpage * runtime(comment): clarify the usage of 'commentstring' option value * runtime(doc): clarify how fuzzy 'completeopt' should work * runtime(netrw): prevent accidental data loss * missing filecopy() function * no whitespace padding in commentstring option in ftplugins * no fuzzy-matching support for insert-completion * eval5() and eval7 are too complex * too many strlen() calls in drawline.c * filetype lintstagedrc files are not recognized * Vim9 import autoload does not work with symlink * Coverity complains about division by zero * tests test_gui fails on Wayland * Left shift is incorrect with vartabstop and shiftwidth=0 * runtime(doc): clarify 'shortmess' flag "S" * MS-Windows compiler warning for size_t to int conversion * runtime(doc): include some vim9 script examples in the help * minor issues in test_filetype with rasi test * filetype rasi files are not recognized * runtime(java): Improve the matching of lambda expressions * Configure checks for libelf unnecessarily * No test for escaping '<' with shellescape() * check.vim complains about overlong comment lines * translation(it): Update Italian translation * evalc. code too complex * MS-Windows Compiler warnings - Update to 9.1.0448: * compiler warning in eval.c * remove remaining css code * Add ft_hare.txt to Reference Manual TOC * re-generate vim syntax from generator * fix syntax vim bug * completion may be wrong when deleting all chars * getregionpos() inconsistent for partly-selected multibyte char * fix highlighting nested and escaped quotes in string props * remove the indent plugin since it has too many issues * update Debian runtime files * Coverity warning after 9.1.0440 * Not enough tests for getregion() with multibyte chars * Can't use blockwise selection with width for getregion() * update outdated syntax files * fix floating_modifier highlight * hare runtime files outdated * getregionpos() can't properly indicate positions beyond eol * function get_lval() is too long * Cannot filter the history * Wrong Ex command executed when :g uses '?' as delimiter * support floating_modifier none; revert broken highlighting * Motif requires non-const char pointer for XPM data * Crash when using '?' as separator for :s * filetype: cygport files are not recognized * make errors trying to access autoload/zig * Wrong yanking with exclusive selection and ve=all * add missing help tags file * Ancient XPM preprocessor hack may cause build errors * include basic rescript ftplugin file * eval.c is too long * getregionpos() doesn't handle one char selection * check for gdb file/dir before using as buffer name * refactor zig ftplugin, remove auto format * Coverity complains about eval.c refactor * Tag guessing leaves wrong search history with very short names * some issues with termdebug mapping test * update matchit plugin to v1.20 * too many strlen() calls in search.c * set commentstring option * update vb indent plugin as vim9script * filetype: purescript files are not recognized * filetype: slint files are not recognized * basic nim ftplugin file for comments * Add Arduino ftplugin and indent files * include basic typst ftplugin file * include basic prisma ftplugin file * include basic v ftplugin for comment support * getregionpos() wrong with blockwise mode and multibyte * function echo_string_core() is too long * hyprlang files are not recognized * add basic dart ftplugin file * basic ftplugin file for graphql * mention comment plugin at :h 'commentstring' * set commentstring for sql files in ftplugin * :browse oldfiles prompts even with single entry * eval.c not sufficiently tested * clarify why E195 is returned * clarify temporary file clean up * fix :NoMatchParen not working * Cannot move to previous/next rare word * add basic ftplugin file for sshdconfig * if_py: find_module has been removed in Python 3.12.0a7 * some screen dump tests can be improved * Some functions are not tested * clarify instal instructions for comment package * Unable to leave long line with 'smoothscroll' and 'scrolloff' * fix typo in vim9script help file * Remove trailing spaces * clarify {special} argument for shellescape() - update to 9.1.0413 * smoothscroll may cause infinite loop * add missing entries for the keys CTRL-W g and * update vi_diff.txt: add default value for 'flash' * typo in regexp_bt.c in DEBUG code * allow indented commands * Fix wrong define regex in ftplugin * Filter out non-Latin-1 characters for syntax tests * prefer scp over pscp * fix typo in usr_52.txt * too long functions in eval.c * warning about uninitialized variable * too many strlen() calls in the regexp engine * E16 fix, async keyword support for define * Stuck with long line and half-page scrolling * Divide by zero with getmousepos() and 'smoothscroll' * update and remove some invalid links * update translation of xxd manpage * Recursively delete directories by default with netrw delete command * Strive to remain compatible for at least Vim 7.0 * tests: xxd buffer overflow fails on 32-bit * Stop handpicking syntax groups for @javaTop * [security] xxd: buffer-overflow with specific flags * Vim9: not able to import file from start dir * filetype: mdd files detected as zsh filetype * filetype: zsh module files are not recognized * Remove hardcoded private.ppk logic from netrw * Vim9: confusing error message for unknown type * block_editing errors out when using del * add new items to scripts section in syntax plugin * Vim9: imported vars are not properly type checked * Wrong display with 'smoothscroll' when changing quickfix list * filetype: jj files are not recognized * getregionpos() may leak memory on error * The CODEOWNERS File is not useful * Remove and cleanup Win9x legacy from netrw * add MsgArea to 'highlight' option description * Cannot get a list of positions describing a region * Fix digit separator in syntax script for octals and floats * Update link to Wikipedia Vi page * clear $MANPAGER in ftplugin before shelling out * Fix typos in help documents * 'viewdir' not respecting $XDG_CONFIG_HOME * tests: Vim9 debug tests may be flaky * correct getscriptinfo() example * Vim9: could improve testing * test_sound fails on macos-12 * update Serbian menu * update Slovak menu * update Slovenian menu * update Portuguese menu * update Dutch menu * update Korean menu * update Icelandic menu * update Czech menu * update Afrikaans menu * update German menu * filetype: inko files are not recognized * filetype: templ files are not recognized * cursor() and getregion() don't handle v:maxcol well * Vim9: null value tests not sufficient * update Catalan menu * filetype: stylus files not recognized * update spanish menu localization * regenerate helptags * Vim9: crash with null_class and null_object * Add tags about lazyloading of menu * tests: vt420 terminfo entry may not be found * filetype: .out files recognized as tex files * filetype: Kbuild files are not recognized * cbuffer and similar commands don't accept a range * Improve the recognition of the "indent" method declarations * Fix a typo in usr_30.txt * remove undefined var s:save_cpoptions and add include setting * missing setlocal in indent plugin * Calculating line height for unnecessary amount of lines * improve syntax file performance * There are a few typos * Vim9: no comments allowed after class vars * CI: remove trailing white space in documentation * Formatting text wrong when 'breakindent' is set * Add oracular (24.10) as Ubuntu release name * Vim9: Trailing commands after class/enum keywords ignored * tests: 1-second delay after Test_BufEnter_botline() * update helptags for jq syntax * include syntax, ftplugin and compiler plugin * fix typo synconcealend -> synconcealed * include a simple comment toggling plugin * wrong botline in BufEnter * clarify syntax vs matching mechanism * fix undefined variable in indent plugin * ops.c code uses too many strlen() calls * Calling CLEAR_FIELD() on the same struct twice * Vim9: compile_def_function() still too long * Update Serbian messages * clarify the effect of setting the shell to powershell * Improve the recognition of the "style" method declarations * Vim9: problem when importing autoloaded scripts * compile_def_function is too long * filetype: ondir files are not recognized * Crash when typing many keys with D- modifier * tests: test_vim9_builtin is a bit slow * update documentation * change the download URL of "libsodium" * tests: test_winfixbuf is a bit slow * Add filetype, syntax and indent plugin for Astro * expanding rc config files does not work well * Vim9: vim9type.c is too complicated * Vim9: does not handle autoloaded variables well * minor spell fix in starting.txt * wrong drawing in GUI with setcellwidth() * Add include and suffixesadd * Page scrolling should place cursor at window boundaries * align command line table * minor fixes to starting.txt * fix comment definition in filetype plugin * filetype: flake.lock files are not recognized * runtime(uci): No support for uci file types * Support "g:ftplugin_java_source_path" with archived files * tests: Test_autoload_import_relative_compiled fails on Windows * Finding cmd modifiers and cmdline-specials is inefficient * No test that completing a partial mapping clears 'showcmd' * tests: test_vim9_dissamble may fail * Vim9: need static type for typealias * X11 does not ignore smooth scroll event * A few typos in test_xdg when testing gvimrc * Patch v9.1.0338 fixed sourcing a script with import * Problem: gvimrc not sourced from XDG_CONFIG_HOME * Cursor wrong after using setcellwidth() in terminal * 'showcmd' wrong for partial mapping with multibyte * tests: test_taglist fails when 'helplang' contains non-english * Problem: a few memory leaks are found * Problem: Error with matchaddpos() and empty list * tests: xdg test uses screen dumps * Vim9: import through symlinks not correctly handled * Missing entry for XDG vimrc file in :version * tests: typo in test_xdg * runtime(i3config/swayconfig): update syntax scripts * document pandoc compiler and enable configuring arguments * String interpolation fails for List type * No test for highlight behavior with 'ambiwidth' * tests: test_xdg fails on the appimage repo * tests: some assert_equal() calls have wrong order of args * make install does not install all files * runtime(doc): fix typos in starting.txt- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdibs-power9-21 1733397741  9.1.0836-150500.20.15.19.1.0836-150500.20.15.19.1.0836-150500.20.15.19.1.0836-150500.20.15.19.1.0836-150500.20.15.19.1.0836-150500.20.15.19.1.0836-150500.20.15.19.1.0836-150500.20.15.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:36697/SUSE_SLE-15-SP5_Update/b9ed4107b9e0c2f1e78d6e3cc6430fa3-vim.SUSE_SLE-15-SP5_Updatedrpmxz5ppc64le-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0836-150500.20.15.1.ppc64le/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0836-150500.20.15.1.ppc64le/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5a6a8964ed1dc2a0508b0582e46eb936c9cc1e95, for GNU/Linux 3.10.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image##R R$R"RRRR R R&RR RRRRRRRRRRRRRRR#R%R!RR RRRRR PPP P PP PPPPPPPPPP P T%x-ا9RJutf-8609734a6cb132d8a272b933e2cabe4d43f3add4da0642d47beb973bcfbd16457?7zXZ !t/4]"k%F #.4G i]{8i-2'r) 6( QFCJǠt:Gm隺 {i LkuR;6Lߍ$r;lIoEϳ#o;':G-'Dn&ʩDas=4\yA+@b ;FahĈ*m KƔ |{_]~l@сxT+Aѵhx.ǫ6qDԉk Vcρާ: ̈́^YrHr"F^̿@> ~arT-/Ƨ@+C]>K6%AEvXLLMW*,֤ǰg0]eܪG3!)Ó2G68M~<߉yLylFwv<syl >e~沶PĮ; i^YZ[ .@r 4H/  PkO<#ߣ˼Q($AzIR3 kzn1#2-. M]GpsjȠYVf=p[ZP|)z/4:Nw_IjZ. ptfed# 7pK6=$q2QGzXV&u'ˉ)}kRS?LOyV-9~p, E=P{f޺z&?P3U5Fz_owR`'sjyODCЅ+$Th!Ĭʜfm:K{~m&FL.!lAQ$֒*gKEC.b QMkuP/i ]bJ] olJW2OT}(<ޓ>~bWC31t|$y5>_14 wBVoKt C$ |lxyzbC3"nv/֑ݪ :L*51Y+Xe2h -ҼZé<)bHߩCry5|6@u' @T %x}i q22$*/Թݺ䂛= ,MKs %m`SdQ,OorG* b4_|+K6inG"P&ћCb5'ITC֔ yiSs2a4 ~fCBw :DU|;uݛUƄܑ!Dpm1۴_W$-jSА_i[+lV7#>7e5 $+䮙4OMYȗk}&SN8?Lk D\*tB ߷q%/*= ]b;Yg_034O:/*+>@y3£*iUgɂ.f8km9}u(vTf|E-MrrCv j8'*DL6MT֥/iUõl&\i:wKh|) 0i ǎ,{ST v%Q*+x'-1"Hnkm$8ލW8npnr-p"jO!)1cwQe#";k7i\h߇ 0pm,\45.YN C0^_̏1 )-: n(*˶xa _CbY_ 2$-Ui4[?}dDD<؄z .HvSUT~΅ %jFru jZrJ 0G.¿Q&Z4;d${)4n bMah7+ k ɴetydŧ-oC(9Br]wӲd\ʨq)I?nVJ8'W+x֫$BWt/ėoɧtڰhTM̈!1Yvٰ [w6y=%;p">a(EI26z]BjmH5TsHL=65B4nzw Vy8l/^<׍HچLVZ P-\;ċ2; D+!d$bVs1qR)#2x8Q{eƒvoRG &%/,=.m|p cO3 :m'W4ŕ"0Z{'%xePJ4yi 0Wɜ6KbMl_(:yD Kx>/ـnhN<Ւh;V?[B5"'cxl )@p3@*l3@j!.v,nx[6vn&~Z >8a^^<C(X!s=LJ0m~3H?K$ۏu-¾kЍ૚ TV."})83(Zݖv^.WC+Q芭1:[} \2?RICJ >IuŮKD A,C_ZwzmJ:&ȷO{a %o>H0~׻V+`™/i&TĻO\5a ,;"BT<8š}4@=Zýf^L\P{ψ/)@CB)Fz">]V@K__Zk_ |{SǼoph[}0%8\) #q[  62J\,,$nFah"Z^(JYEwoi[mƏ߯g\{ fiWG)4Ln|lY--;ێ7 bTt>@k6cPڲ"}|OEg>k!q̟6 i%q?K۴%B>Ppx5md397\YI.~(ڃSq#QǓ)VjdZRUnxlUDr *'Z,v`d5Dy\PT7_[n6Fa7뼀ȏ(ߢS[h5fBH!no8B_ dM1ƽ(h{w )?s^9Z?}<[T"/ŨAs)R,Ŗ!<ͻSR9C!S5t\Q62<q:*ܱKrZax1]qS<]YS4<ҵ7 Ρ;a=ŋ J}ʲ ^Bs]"o ֭JQζ0ܵ -!:^.p{oadI:)%&V 2\ ?%lL뾟Y#D'8lR&֨g=b2ޛue NN2_̗(N 1jco@oaih 8hޖA8c5t\}PbShјJ3zb,~GFՠQ[3 BKǦ]ݘWDh+`Rk)ʌ?s!la5!-lRޜmb 6"nnsi {: ֖jhti7+1^/o9 z/6lUi/4Nt6uU_ ]ih# B'0:Z*|; yi|P?ܖWafURD>3rP:U#.pI7 =)HaC[RSWP89.[6Z+ƂV#eg Ȼvom⹸Uذ`6,g#?8+++3k5 Rt ,wCROaZ[ IDOl^c*66UfO1^6N=_$=b] 5{H}АEޏŵ :AVl .*Ld"B<,?..թ@`ӚMsswmB'N@U'/.kF7MdU11ao $r./Mibk 녅MTb+γf%Sl(\pD,y|yH6)_CuBA8¸hjZN)m-9/cA`*hxMAvGwO?V<(V NUi(Xz K4M31Q<8OZ<3kvzcȩ\VkHBRWfGrBp5eԼJ > Yrtw+ӯ] ޹ L@S}1I"ۊ*Ja%ʂ?/4b ZTVu@M A-婹7T:vy eؼ--R|@q_1Rmh5t (T+|{ q}ҜY_c8l>ǒhM5^L{kIE`hF+k``őw ȕ 6?+1ެ1LĐ#t3w>HgrRuɷ{ؐ/m)IAfAX)`!Fe]$A58b"dfXesʝ:%;GOEޗtDMF+4HZ=HX%8a .*6nZwH ux#C.ǶvApŚXlS+H/xTQ{nؙDv?ީ§;vJ#Oca۔[}se)L6i!>/Nb,05 )Hc5(}h(Ȥ3AW/e4١n%is Uۤg- קѕͲ9^h&нpF@jc߬I1%"O hUx,iѐrb0.@f|BQTK89~u}fdBg |yj}Y'*zsN7prn?%qdB7돴=\k ]t=%% 0)LJ2erA~xKPwxJ$ GZFXvg  J`$'I8'3,W}+L)ϩ W#Xj~x/ѯNsY.lUfW6n/aNO@M=(P:f1V| b+.sKrB[`gH5?cԏoz3ևɣ>,#pFo}j$eS8QbQJ!&S$raH 6hM k%ؕiP`/FzXGдVf6}rfQ$gjvXr)_RܹQ<^2+-ӻ>wړMJ>Mտ/c{*@2TG Sr OXt8dԒ:ϽؚJ\(M:j$SiU@MDY񐈉lbYH _k+C`@z!=aʮ&Ccf'4{o3_:9YKP 40KcC6Qj)m:,%@t]9Pl~ȹjaboQb>o㗬h>ԅP,CVc> §LMADW`[DEJ}3Pts$pKЊIUt z\!COzلix[zڊJj_ؖ+ȗeX6W wllt:L}W-&S, s(!7Iu򔻧?,ʸO }D8G(I\:tcw3O\! ~#I8JeM±#>sle?``[ (0cE@_, .RUe@ 慕oυlx$w!>ZN+muIc|T/!U{$N8$^h:;µ1$mqɓŶsd;Q6#zn?\eDVO'uݖˏKdkScXh=YGdGfb4m#횆ůB腻NP_rjp a`ui[ lMӁ;g|M(=*H18C sk 5,V6#)1w8 75}&=$5CTvيRRU 18R[+m-ի,yN rEvٗ]RHa`9H7_&??inԹ.Ujҁ32l]ح¾-ɥ漰O@K \#ukˑ4q_jG-؆ahnjga47;(˦,~ ">P'$tv>Y?"crQnIM6?(3bph  ׎b6ļ(G&e@{5^\+Ϧe ŗn@Odm(gi[P|#SyDۧČ3C.JuZ>,MOoޮ#Ԏ6r(NmV޲}36.yfaV%RAF@M5 ?f}w(/FyV3sg+9F5Dcw\Z) ?=x@_PJ qSR2ϡ_MxƒErC\ȵ٫&jK.@x8-fo/S0dSP#;nk@|rG uYnjA8QZ1rźO2U!{U1Q٥K`vKu|p&pB(-.C2"Q2QTo:Jڧ Z}][? +C?x<4x$s1^fLi/jswl2G乄 ?nC,K]^a:"ѭG;Q0el|R)C rkrx)B&@Ud9T4G{oIhpA G]DBV;H'pLǕ= g7 5[}"D2G]8/S^Qf64f}eEhoJ8s)ݐ6߈PS8yM=|2T Tr"+'徧 [/1uElثPKM]CCeDހc# 6JʁJdtSm<{dVtξBNؖ1s/ۯzV۞_^ZNo1MرSJ`*Z#+ '%FZmXZ64a!bX#04Q:#$CgQ~! ;gOs=3WKN|G&S6V4k<6l7$gplu_vU|AI]n-[:BNJ'Ž7 unWeX]SBDZnA\P:?=;XBc{7Uiql"۹Y߲1\.lg >Q&ˠ&*2$P: ý[r P8u( mBB>j30[.!zPX^7-j20|&jTІdމ+?i9G4sCҌ"2XˍYsХ.Db*(Cv>]e}( v~y/-&﹞/@>L0rQf0eU9c5oAl 'q&\\VAIwZ ^jNdT=ۺRkgŰ= ?哔()>L׳ W QtW1ʞi^x,OQaOt>f2wȹ}t' /ZiX҅ H |''9mi kF/a8kbg ϾWHj!6N40yٖL:l{&U:B:>FҌꢱHqRLkvمj'); $K^sLE"@>#<א s,>!'p?eBúT0!}c6{! Oغݗč+7>gDn65D4l<3CA.j jpi|{o3$FI`>[P &D瘱~ُmb'74W}{$T#^\Jy{5])YE*vi.> >tz;h7ql$]? E3Y9S&97B9׫H+{r`\\K֍o!|}#|诐qr{Y"߽EPE|q H1~ Zr5Мe;I;#bX;9xygq1*:NLM<-!OUT%#J C\J@^씿\:]U:E;C};=Wy|C+w%擲%lϲ%ѽx)#4]Y" LrBbl9bytF9ʐC "u f$ hdG^59ڧ`w`SoB((!Cy?ַ3eL^uy˻ڊu9Nt|Ty9)/7xbDž*LkJw 2ZbT+/ᵚ}Ko2@c4%].^Ce 5`aXa訝sv`vIZeJ YH]exk>E,+m2d D(d*LʁYF"wKehVoran$d2ZO^DL,܅ndkxUӋq矊~C甆ޅ4`kr⭟Q'i=!7ķ=2{V>vF R1X> ~`x N,> .`Bdnf3>RJzL n}2@Z]7Vss?h; '8l,]8b)=FtFUX,j&D.% =ث yBgϣV|#>HNʒ̥ ˆV+%\?s/%DrAjmh|{iC+ ="  TYZJq;~kFXQwtC#DxK{T6gЮ|A攋T‚4 /|`h+p!rSYNȳ,'UuE-~* Sȫ.!NsT0\)yKu'!6[KG9(`(&e*̍c<)2ur;#ctE]U&U⼄s=Ig|oT>iW{^@Ͼо+#sW?[@pG]h&=eZ9>"{7f[`⋘vv% 9gD=ru+K5N*!\tV@$.,8/xC? K®c P|g$Rw9keeHȼs.F]Kf| vAOy!'| ˂Hq)(tDU|`5 0wry(yDbF%u9%Զ ?A#1GTD| ֦jXSڈEeQyʺͩ5ǰ`ħVyrr-.6Ȉ[9/R̺6~TÛ &z֌7tOa?Yi63٩А}J10'o:7Kp i./'p2.W.<-4OMY^"`~7̩~ x:E4caV&-b6⊘{tG'oKhWW*LZmf pe`87/~@hǷKQ(ȱ __R h7.䥃lvPJ&؞2fmi,,{stj,lr 2k.{x&iY뉇e9 .g=&>\wwݟ5,&Tgq5XD.F +Yct`-U4rGO>-S,^_.5.F ~_r;IT3DR3)/<ҋnM5(t-Q,N^0ڞ YLrM09 ءΔY9 Fzg+u h]*}ζ̩TcD^r%msj 5s`fƄS]Y5,t|+. *qta\>o@aV-uxdVtɁߣ5W]֖uu86s.wr z>9'dTc!ƾ;bꓐܹA`(JS9ʺD2DI"ͤ{Y%]t])T z魸رnJ NA+14<ӻO l450܁~j@)IeQWv&xӪ7 g5k49ܣ+_V'f0<}gN \u%q/GgMl5JJ-֘ gca!D[ģĂ`+3U[L>-T-A5@1FujZ]'ji[ISdL}1c(b_/X$LZbTx}LADnS$"]-⫧S\ֹe)#d/sm&|Yz@ T yYcD%J -2<@RI9{<^dsV9AUFǩ:, YE=}TU49娎L|nt(P!H`1 o,@j꿤!NXVEՐ@]`wǻ7ڪ>{W:92Bc,rZ`M_[}6t&*9̪xc5s|gm)( S C/q 3"1 g0YW)@4!MK_([=O.Δ|ؓ|7WL;ƶpLc(!.VL618 ?y,WZh ikDNngoXÜl~uZ`ekA΁4ʝ15v`9KC.Ճ=K(N?ƀnQ\4/k L`e5V4f4< g?/hTGʛLi")BɗQ苜1rkdE>,hWX(cPMtJ-`o;BpSXCE (Hgfʛly<>SL䦛:eɹV_Έ/kˎ#C^FEOfe=ⓡkshXxCp8>(ɞk(z )`;7h¾A]E@=cH"۷`)e25 kEjQwHvB߅rc)DO7*۱Mդfֻ:1 `T&c7џ C0n bw". F!dlQ0N?#[GRP |'?f+i`m $,l TSEQA2E%P&`~(l)7h@pv5xBfZVp+RTs ڷuǯZIv<pl{TOM u^ȥ5u'a9YC>r3DoEaGAREOiQH6 qB<'C4j5c&IFt 7vC5RNa17d~c%[M 5n`+f4CJ rZN%!m!D.7Lj/L^F,Z,B?fg*{oQ~& a4֞ ;֎K}Fwa-$kyiYkxO~!%=~DOr9,ٍ & 1EyK{(4Q$% ֲAJ'÷̕5o2!F=L>UKf![j,p6!LW`6@XOVE!,gAz;V2sG]‡ _H3x#D$J"&/]Ӥ|3P=iTc d#|r]iD}9ИD?+-DݮBݡ۞8`gB5uՎZqۈư]ضebC?fҩ0T=,?). uC$%A%qAGoe&mh(yshq ݛ”fpux)~Q Nj`p52z `o Yf$H_&WKaz[2O3n,~htz+wv3-K͑ #hZ>SIY*HEQs~69־.ie]L3)g=+~fY&;^vN7/iRpQ#'P\[hQeԃD]H C- <]P39MFU|HF؝'`x[O^J7c`SCyWkҼ)52Qw-Pn%!Cr&50 e1C;bZρ%h3 x'T@*\g&1Rt3tG}0jLKZ`0ŒwMR$Tݽ%t:YI~RF9]i1"tiٚ7iۨ&>ev-ܶ"OXQg߂X%.gƐ?}P/NJAO'#c'?IAkHzKIy%#!3RV({З/48eu@+sSg*"f{^z؛6c˟:\6Ns $b9 X)+9؎sKJޡPR1'jRn: ޘA;o\#.׶sLACXYDC5'kL&7vePЌL3 x ҳcǟ!}cЅ-׺_M?9clz}2npᓀe A-Yc ^]!b: ?dHXffzȴVO;KtYB!ªz:p8d>jm|(d8+^cQa{}ZЍE%!H3"(/8@ *$m Q0㬟 e1+L2"O0d6 (1$gO /xT. .;o8kEx)*#Jm+y3;fk^; ^+sb!lf7aCkb?ȳu\2dA~3xfݹT= ,6YЀ Aęyͯ:(4bdhc1bQ?+R^mMh_ܻ uv\6d9shqdU|a!S D =oxi;>QK Ig^C%d'sH`}$ӂSSZqৈ#ЄE>X2JQUb$F7 edz_|>aAE>\!XH}t!s.9 oDG8Y8pXk+=K#Z)&œfof@ڬUD< X{~*a50 FǦj&.:LؚPWw )_>(CB^ҽ4r.-xh ˴:$kƻ?T'&&S`1;r9@gV`&*`W߉;}5ؼoD.}&}p %<s' {bϻ$tkyCz?\-l zcшHĢޡ[sH`ڍSJ"gVSlzh$pZN<.HT"2>׼a.J:(/eҿwQfXCHWi jrL:U#Li~fP ]}FmW\L3AUOB$L`\~JX|H.P-տho3/? oZF[OvvUSڳASxB= cpږGWL@$d1U)!2+Tak?u GMI6<)!ΓT}b2ng;~㫱M!|Y-:$ h !MAD}AB2x>"i aB ΰ\!F2H/ nx0^ӳYf 6D(̱Mk0/SexR&[7@e3Sl ػU-4BtLV_"ZRH6ID@/h02R`W5uxa ]x1?6T=LS+OǢxPj[)DMd32ԣGD[z\ QkBuht3g&ah-˝*J-$>coҜ'"9r2q#97&X|5o_\M)E'v7W㖆Z=`mBȭ:@8pli%ZVU 30',%+9Z?Z438=YCdB+3yGK t7 QX{p_:6뫆-"8|:rde(5)\qyHA !il7m~yVIɰGy|ØvC3pH9y75_Ќص( Xj-xYk'4 <fx6(S r[JW'}J GՋk=H_uwMaɍfd{1v/ލH)p{8/Y#,m=)&n;5i]<n'GRq;万 ":f&|ШW&u/H!gk.81c]i"Q|،py5i0xGxMi>BRnG]-etf ݥro^Y~ʁ rB%Xwxof~te?3@Q"Q]sKHo ]ĪWHޤeV|%$'?(+0vfdIUPF0s @PJ<O+Z恮ᦶKh!>(Zyp c_:;|$:3 xz!%];3j'MScct2̊T]UWf"βDB2o/2 ~xd3lN|*w̉/L2yj4uWJ䅛\KSvc5ך3u5·kyEylZ"^SUR0wpYYN6*sE 6 ,*g 6]_VbkJ;cuX;*yL]3(|8inAC2&3;LrrY>?+҃΁??| sKеf~/ d8Џ̉䚖CCvV ΢cjڳQhhP :#6d"6VEeW&`b9kх֛?LZ8#7Aˎڊ=Bx<#<sf ;?nF…p`2ȏk"}z/2c:xu>L-F-%pUu$kCgf?U1[]0q{A_p D>6{usʄL1ٗ(H^pх'4(2-t{qdru,LU=-jvRU@P 釥Q_RZWyg뜅EQ+ N"hؽh6l=!ڹ6">=Gh0g6*`Lڽİ!0w*5$\_-Tm4ĨkLLZ[;."N}?2`S͐%bSiN9TDg\CPbA+ kyfF OŎ?3o3 ަ>Oګt/B |dv@|u%YqLI؋aD *8V`,y|wԋJ!W<`=߾|&PRbL:tWޥNŨmN`8k~߈io.;3S_=PtHKc%ws3%V3 u"L9y.Д86?|w0[q~c.Dp8 TmF *tԁ`~)9wwRX!KQnv\d8Li׌|y R͹OoXv&4Ak>T`ٚ+~ Ibƈj'|p8a!8RԔR tP0J90܍v>/X;/]}Ǯw6FI'cnw @y#3Rt(#?Ya!s }ToT2I࿣C>#k'IUG1{P+89[eV/V+Jgfz;YIE>lMqf`.M,D \*V/uPpPQipОm4iY-];vb011gTrh.}+j&U7R:QpH՜O6ޫmyЙS=kej;_l/Zi˹Z u)-X=C]Egn(&0a^(A tuBW$ƴ}-F_ӼrTGax9U f̆bDm_.:رVj9l]38%k=BNPOz6Hb?Ey4m8 ª`Qkُ눙C xא P&=ۂh?>CӿmMGB{4q Y7/M-OJy/ Z"y خO-|[R B(6z(U1Fcm&-hy]֋Bv𮩱X[ t83jd'7mD}, &X! pa rВ_$"y(HP >A5g1b.Lq2Yo}IhP~{ _Q9+#Z\BfF}aƁ޷Sy]KNo>-+fӤԘͨ:XA繵l&!/GUNmR^x% X@7#ŋQ&XE~&]`1 [yȫ"V8ț$cbdgyXt a6~_6ޗ&VQF*5O8}DuS\1z B_6s!y;[}I7!܌Bx LJ+.D{Pz$S=JjU)\ICuKQ5.'ԼȘ{0=RqгÅ ò~j/sD@wNt*wo{iY6G4fվfVTa< ;{Q셊Ħ ʈrWqR ɜAqVV+F qS9P߯x#6R4ſtf 9=Oܙ\ Kȍ/hl-rA-RmChR>En_;&!mLWtm>A-xrBg|'*q *j)α|wD"2>E.ޤ^EbL; 89G%v)TBҰn&[߀-=_XݢIfOb'G}Y䦀 13]ő-:mmUYEfX ##x$|&Ϭ7o4Kez^,yO@q=w&|C3&)M/{΋y5v iq?xth!3?%ۢ{6hMzA ?vL}n/tx#H~]%B,,4FmUo N{k\ ?;tA<ҧؠ;*<4IJ `;p\*6IEnQ v7X닃vͮUپHFpsV6ۋ9 -Vw.o:6kg.<@Iu8Hg{C&xX NAnY #S8 m !c5;gNJל>&/FlUq}O/9i$@_t2 %YO4vTQI׏~PR ĞD޹_;X<-g(Ŗ2 ʵj׿)D(CKk .7ւQ132ni1"B"oEFa-H9_  H٢!*}! 5RVQW/f-vUO'# ͻ+V-¿g&*&GkͺeVrFbK/O/p}@\sw9XvDYFU,@I&;sh*0m ߠ3`1X㵢uc9@(M*COg,Y6$TJIp1ŚbwBIۋZ? VQ;BKȦfgJ_8U EDf.aW@DWS<3U,5RrBp+qtz?]~cX[ Lu ,F V(V.-9Zq /w^bjAbePå/ ~NCZQi&(dM#NPH[HެE E.)hS-Nx-T*@TҌWT{ P8) \}t%  AəsRIK> ' 7)98 +@~?[/%ʢ%TI5 ޽CKq"WGik\)rءg"hf8v#N~>e ) 'o0I9:L"c}8x(O}NNBxn8FBZG|V}rp`/RM_Dp5 _Do˜ qj]D\\i^H'qPddp6Zf Y3L 6 9]jk[ɒa&KS3,HRɁg#,3p)6Z+lUk0fX\?΄D0_ RT,yb EE";`E i dǶ={[3|_,`y>zL199jT?$v6ICjS'݋=ҵ\P(1 Ӡq[Xʮva /#CfY3pE.nu$4z/AAX͂ [JJa~ P&^#.q3u}FHg՘Ll>YX 5\A^* 2ʠQ.0r ՄXzrUU / W3܊lVTV?z(l 77"PH;b9ykp"r|PBwۖ+Jx ,~*S#AHAnR+ù0׈}b{){U1jp|~EY 鋒HU+5cƃS:\B-P`ܝ䕓}Q#Ns7'f)++]us7aMܡ9e$%o;X|(yw-9yGo(@h YQ1 ϯ?Z7NqG) αL\oʵfS H|oP "ئ"O=lbdt:1PG\ͰazGL\d 1=IϻR׾ +%;~X,.TU@C/>< >~YO.DN@55ƾh%5+pCóg 7&Nr|J:QR+Jd~FR/AHC1vKuz;|:O}qBꝿg8+i5<`{ .DO! FE]7m `q/>ǘèQd3.1ˣ'gFS ^q6$-1).n0t _bm. i["y){z Oq! k@zcDe۬׭ WHa|̢QJS\< )L{":y]Ydo G>F?,O30^I$)Xݺ@ɮPkHLf A#V*?ШaֺNv > -Ut⡱`}3Λ=#JzubQ{l7T^:Us/kM) &2(ߪuVoԈ>eWW!zsVb VC*7o q6EL bN|ʬt|&а?wâ05cDZ:`x(9<1EQ @߰'>P}k2Tk8;:gCJM sS,w.L`ju$IVF4 W]Z"* .-SűIw( 90r{RAGaY,Brذdg{`,! `ؒ+5sz$+r5Pe]{Qxy}2Yޏ AdOew8':ϲ̥әM2 Cȭ1.c`"AXgb&ѴS4@Y4gEM[qyL@6hQ~r AFj5Gnj ugR g_HHZve5;~i+7'6R-䘓&rhI#ˎEB.= w:BYfLJ  l2PfD@ %_"3=\qvi,oBAkQ8KP)6cӿHk(167ع ?@WrY;j9GG~^ # G0T7 c2sl',r=2?js0? #kWPwP 8? 95]i!'}y@x5/ c9@M HbGrR})g4 M\~D|\wQʫh.z}OHGLM "{MZj繛lF3P^KE0)Ed@&{ZA5ν4ֆ\I|`qb0x$Fa av\P|[.('Bt <;Cm2cNbu/ؿo<,iHz->9lgB|l܌~p~p/T{yejiN}n䲓՜RވwUoFY/)1/ovn0ժ86J;FX?uozR9h n|S#cXkLtV 8qm|Xd:8$e_K*ķC>AۭT@fO?IUwfGsl33䉡jI_R bT 7x}Vx%f_N,o~.c]I%nxhr= nђ\KsNjr4 E8-t u o(Ţe(c$K":dœA=X^Ma-q[/gkh:LKmH5D$" soY-a9b0hQt%LPI[s tble'((|.Wl f超~ir;y4N^=޽od>rQޓp|p}܆;ěK-Fb=|Oq)/%C\*`CFH @g"&#hB9EV8{*|K؈.DGmJW`Scam59ؐt4Cw叅^n\T2HF#D૽BEuDZ6f40`ۺTCH%_l3qcNN,rTvMYХwf]ń h/6*Y}ّ@X| VMUtSe}<Jm<+I _0(qhMJbM<8*fdDţ(/:4q+L ޷M@BnO&!m|gI|  GE#VaWn$Qg8uFC0^8q'(Ey!5b7M "騎%bL>I'Ţ%Ԭ&2j`cOt/lF?NJW}-˗;33dAQ@W ]& 1:T8UD(#-S|}S/y-p6e6h~g>p{#|Qur<:fbދUD.=',|?a`5zS]F:Q3{GI8?NF = NS<g8,a˓ )Z(0r]mVZ^Hg^RTLx6s<䭳D~"p{=Txw`F %OT;d(Fe%.q{L+@iaH|МﲓBx(N/\fWy?%|$Ex91 Uփrw~5Fڅ4R('ݩEl YgJ·b,%etlbSY%#}VqT <0KP7QMX3䱸r"oS:L-0t(mf&0#}mXC `QL:cXUmp7)lY]üQL~2G['ͫ&C)+x'r_kQWsv҈?6+/]ç泩 F~[xP߇Ȁ/a0YL;v~4,e|%z$D`tN(r|g{b9X?U,PdnuuA2  iݘWpv@yuUt],l^̀[ƒUG[GkbIOL0#:M4[oV[Y%ATsu:fG4p;PD ԑ Aul=rsP/KOMmi]q'=tl`MJ0"D3nclCDGPN3=; Ml9F&f}nBЀ󛬩t0.tD=悃Nb9&.)&ȋUU eLH;,Z4UүR7֔^x!{C 1;S^.bȷs:tJjJjBc=lg 󓲨ߑ9&`ٓM(У;u-z֝Kأ>(:wzS<4BвЗ$IPSkLJShl6pgRg` T/u*uPFC a\/.ҟw.gסoGu4y)6_9Mb kΦ"c teъ7/@6}zkx韻nRhm yD'?GX3Bh]Ӱ,;`&ԟ>}{2 uF8g?Z\\P#apTWMF]V->1iVJݧ 'JFO0붟*Ε;A>oDo"qa,7PLn,p[>UvXwe,d0B L=K9. x66X)DSGSŀu|q)sՅ.Z -&K9Y/IYz+=XLi>o`,-2xRuFe @5=v%0jC%+Q= F5Rv6rg`c aߟ9D" L--G|JS}Mѯou \FF-.6B>i Oe[?'NjTQv_Ԋa' C|"_owl XqKT,gD[L {"m'EGfJ(+ƒE25X z˗է+A']:kb8YK6gJ,lOKEz76^ثITzJ#Km.\)L%%ok۫[B-D@ns6o?ِۄ ^` ㄽ6Kǭ m]>B$B&_ BȮ߯+X\7Q\ema}^n8Nz| {/kvY5հ[<\2+-U*mFr藵.Df<8oX= ShQ tdΚgĸ6Cϕ:cwMrA1.fyŁN7._ @3r:svJ_}XDџ7 P%oaVLMPcb'}G2'[T5!Gv}aw7Y2lo.*W= D[=-T9@H+ :hZ۟_٨~Jy"ʶU7FSvJAd&S(S{7pA̤!29}0]m(F,N \ l jiOUIIi {u'cڕCq뗗+>ӌ_rDyٯ{"{: $iF$)y2" ,妚G=ǕؑB/K̏2MơS}tc:vG4j/"Q0P 1УIu vb#}fήp~y~01v %H9Zi+HN/,W1]ėWw8ީ)>aQo[MՎݑq5_;9/r]@ao/w Z1 I;3 'D~opߛYmcĆ0 F]حHtOotDk" ){˛diUB RxsUfvg7[N>GBf~3fǀ=1'pNK]heo4]7(DiKם +<7B=,9@s MtWһ)CJBS]ھ$O' CKPxy9AYZpWS6ȞdzvTs컮.G =a ? k,~ٲZ`i0P;Fe< Um'Y,3 >ù汧#E17WҎFAy{CE~rUljtA8O)-gtvb cG^uڈC lܞN-zMg}1>A afc18&,%˷K)wM L|MP:IgÎ֔Jqcyq" FZ<1Me"ݒwr>è=TpeYE+&X7\Ge! 82%VyBZf3Ow'2YT/}Q%E'Y?jkyax]^JGK=\G+Ffk"w%{~aiDfXxFKPDrs;C}'<\ſcn *ذ?4 S{rV|G!zq=㷽=Ϭn-$uΞo=]Fv?1B6sh Y2Qf|\͎cm^Qe[{0(Zzzf=kG1c*ڤNګ瀺<8"U7ݞ9{&s*6~_^ ׽vf`n9Ug͵iBjj't ! o0w\4-О%g Q[|x&:`ۻ]J9DWkϥ ovئrn`/4`W}e>UbuKk~"סEy#sD"րz~/Y4bJZE"b3@&v$rhrOJ 9XSSn6Sh@9 乮&&[S3v*zthӫXKc'J3AI.,?o~vX[LH7PѥbKȬ 5%ywdRjerbH= <3x`S.`cMn]O}^Ó+ߚ8T ґ_̾w4 ˗K9h׈6̌-== 4Hq|$}'qKQb#X(&sx!Zʝs2ﳀJ6aQM m̼yu>W1+BV6uWQnrU`m_1 "a¨ryHRڑTZWAvJܳyQHX>峹Ԅ#a M7gïêK^v ޽S_-q qup]"o]oH4ܵ76`HDXlsq; n=ȕB'x\Op dΌ}Gv|iAi'Nb;e>&E&ύ#ݤ]ѹ|9bn}5ΫaMRƪ׽_DeAcI8 s낺6M-<MU7|˸(._2?!ʻ n>a[x]5/ MGU΅j\UXL~[*sE]*)҃,cЋx;*񘬑x^3 94nVL1*2iJ'.rK9EMJ*ߢQ_`riSUluQ:ސSΔ@ {n^K_قʢ1w*[Iotq?t4@W|āWڤ$$Q8J5vu^ĉ)b1l nq}) #!C女do۠/vl_KVBYޞ#$<|&a!{T> c"Eԩ=eש3IB,ڡeB PbJ<8mMQ>(HqtJ.hӃ:A7oAXZwͺ&q+eN?HOEw&`\6ǧީVpǕ_eMSH3y\uNP>ɓà@@ڟ"/?@w䟯++,Pq̃׷ SRG~\^tvtRYVN [:j TF "g+|+U,7$ʄA*dD1#b!QN6UjFӑ3OUWK)j_z L]GfPEZ V0t4lJ1_/ u'Vhdǻ߸JBæoΜ˹"ԺL YՑn|'a[IKP=WM{dqָ)2. O+9OTPԜS!w)Ք)KZ`[MRlhN@ݳi2tuu[\e<H`m![bcXcgpG0nZVx5a:|i xPjJ\ :N%L 6/mz~VݣR#F>΋"R2-pK\ .a16!?,,]d"P5VÇJ/ÿ́yӐϦ ɀ# b}ĞD*n }'Ej{i˴AOKyvI{I w#4w%_i>nI 77s8fh10Z_lwkYVˆ>̀_*=jszϔţIHf&rS ]F3&'"2 3-jsheA+ {]+v Q"БZ~ |\!>~݊ф@c=TX=&{ݗe p,\j]\Yhc(S H+l&sfb KxiZxYʨ}cGЎgd:U%Y-"Ǖy5@qT"\Ns+S/z]6gǛZTdxP>7d-QyD`0:_,*:so!tu4\u 2Mydzl0֪H'x 6s[3' r($cZ6h(︈ 7iHH N8@3}-mFb rC4"Ι&4FУW/AS{@Hn:[hQPe v)MK::x U)\=}4xjIs&ҴI&v)Y#C$Ns Uӓh\ m*uH]APfO,2bOg} ӕ]c4 $]I?8'?GYr[͐Z?vk߲䜏o6>3e7Um~ .|_K+(sCp(w 7Z_ż#"٢dJO4ȫdHDRct'֌< u)Y湕p0OkQPk|wӣV>*ҿ+ԎHE|γ.IX}y8ع@/#Au]V):$+}'5LJ({rHΥw"h} 1qRPHd'.oEkD."@A I{*~ڑt=3ԆN)U\1wi~ :ʶ|co9U &2U0PxwiA-48KAB@gzSaԞ>"4\l] eu;v: U6"\[m%%"G((aƭm9+v!WHW;0N65uu&PX]g?6 T-+_RƲe6,Y8NJڈNdfP禊'#`) C"$#^]{QGj}cX.|BR)V,`9',xMSER)!y.ޡ!ncv l8њ43I}|_*8lFnP,/X:.w( t9Qd gO +O-H; _2yailUu\/M ߮Pc(x4HRΠ(kQ~ەHc*w=!Rڃg7P_.!}l xNHץKY 0 /A dW=% GRvي?]k8 HVSysU`7U/@=~e|"&=*~?zP܎jgjy;7 opճ+H# \x8]6a[`Bs#/[íf?*Xm"5@p1H|+R{)P)Q>jbeBQis;8c )x+S!QrpN֌??WKVP:Qb,Gpa' Jh{ ¬BJ`k!E 'E=坨@!G|!8xބN( < GyGWUҁ\꒕fS0*ՔBFXՋ:B=2e U 4ѨWgԍH׍V {RΜl~ÀR EQM O?0J?^ygX?D&eL2*y| <ƣ?LJ_c5MK Nm<0ZR^O3^,V 0CԒpBh:_nm p: DɎR\ rli20Xq&Q~5[k=yZc e1^SKvidQLyϡȝxl133";'3šRlx}g2VTp2Y=SRrnJG[?RރTGJpjiI,rIY?h{Iz8Lո 'w]Ng#bTe0Cy_~m +juyWe'\i>:Ҡ)V{/ qbdlArTc6Y-: _cuQ3]rD? 4[ W11>Du!Iɀd rGGP"q9ۋmØL7եHFdXt+` To${`_k fXH=W2#J7ר^Z҃2QonTنq  + 0ˎj>Y/hd]3 ;8c#<sXf '=!dSܼݢtOIx7j Ѽ{V 5Gc-=/BفUՈi3\4T3w?a#irQšK:7]}xge]~mkQ Ir `eatxxE];bܦX$w[jQ|,MpK)Kst-7?$ů^\Ik`y[~OëҠ_ԫۣtT)w3/i<[IYHxF2elpK[К[smAL.y;:=o?n*B0OFِf%xwFMQűЉ<} 6j>x7*jw/&R׵2uD7u &{BE pl U$SJNWLoZwz3.:g'^xf|͉nWAL]h#%hHuNu'Հd4|W(>1"V :Ј":~ tO\򎿈t-O+ & -z[eE0Shg:7:j.ayLQ.[ p?I!.)Ua4tJn\* zGJ+,9CPT#x$K`+@ÎM< vC 4%يB)bne%L؟NXyrUU=!MX00zLj-iӰzgYOͿ?J7_NzI/3²ܝYw]xtZm:qtHeH/kE؝XnU)2 ת9^,>10o˳7 Ցgkx;?n&Ct~pVɳSOouaR#TW ޱelrNJ[_ Hnh3,B-[Sb|)yvbZ$:2:efڹN -iG& "C%ow4tZGd& 4?+Ӈ[Z^ƞx>PV ,T[ a>(%*> U.oLdHai6 [xqa; 4M)PՊϳC2~`qOD'giA3s<[֎5gWpɖ0z_+Q}xG' XUv/~|B_i4E:@FA@~] VZnL0&ڇf=,|N)^ejkj4_ܕJZN#9%/)5vZ,>洓,؝p,~c>vȐE6lja 0!/}501T3L1h/niqkTű+13oItnNJ'7CJr`{% ͚0]^כ"h4'tʼnAe(_ᨮpyRWDSDr.f'|Xv#\g+ʝN;f ;;zچbm0])v7y(XMOyH]Kyw`,rO!i ښ!x܄e϶ (* ᑞL^  ^2CuGּ{PDV. #oowX te(됉>֞;Ion|i|37ASi> ޮ[fBi>Жf:X-|US1P끇bBlpPDynYZѦ7E^oei2(RUFh; Fļ~H"M% יDZyZ奶rRvIsO4q^L"8YVfw`9gר^gܳTg"ͬkRC2 J2WOxlnh,#~ u.?i w_ mҶi OKuX*rjȂE1 ~zTUe{R_ۗJȄ Kƌ{ #dexps47*/1jMϼ/ 'T#Pqm /nA\p?Tl:jkCLQ`N8KI}&)઴ :T&ղw$W 달d`#DŽkɽLI.]chC6UĜۥt O}+3+09 GWU2M4?rߺ N*Ǥ.DP{̱ aatI5Z˯fΖb\cW>;ͣCiYqlMbnh 3F βjq>8.t]ǝxZv jfK١l ^&([}¡ZG+6^J!ƽBVRh`Bk֋bzhcBv/b|3v(/U}OB!?qx-s]rJ~ YY g5x/T+jkeQͺ67)W\xz*ٌg{HEdA# y M pƢi(EH#%Ԃ Jn-a|'0w!gM N "Ĉá'9'Wu[Z7Qb#h|\aIa l`uAw|ωǵډwXY~6/9pzҿp+hWyG˲[<śӴUwY|'ylV$⸠ jNg՜iY72"ZP 2He. ?< ;C@N& OYLēZP,jOriȔ'ғIJ2߷k D w n%h,zow`Pa?`~p ac*% XqB+*aZ,Z^#JtZ_,]W.wEhW+5ЎC'сoXewM^5&}W 0kO\/s|nZu`Ôa$K\1K^4chywʨxGñi4Qrd|miI~L8Åd$~n?EX$_] gFcW6YƽMU݉эܞxd_oea rNXc+q$^pH6)--|){K: XcfVǻ< E'(&۵$nQq!glSc԰1CW5]= tS[{MPs5< e XB(eiOU%@0asB'T?3:N+^ vtq. tO߸+G] OH]dʸH~݀LB4AX3kZ[?Ks~(cc)$Py0 628r bD#Yx,H[Ϝd<9n' LMME}z]gW1t%߽g.zNf7ánsMNۉbU Pƽx}ƺ2u1'D5]ݼ^̌+Jng~M[,+8oG^BKcݟ|ktSAP Ws^ܾy}u?z0)M{'] ltɿyvMk]A%xUUwAό'|׫ Pmϸ0Lcmsl`Kjj s'W&<fǴOXZ^Ue襢yjw}+"2`z!5 NHIh0;KxWpFOk/pr)\WF|3bu rۮs\x[=0Xh)i ;OښM[;dB\yH"lKMlh<`rsS YꌿXk/Zg@خ hLaMA SH"ڸp"ʪJLrcgba#wiZ5PcqgnA. -ewb;Ȫs$oe<8^b aabBO8"΢LcNE~qBM逳M6F{yCK |%DD7_fz3셂) Io4w!rLajy]lV11+͢Ҧ7A lq-niFR~FUCfh-Jߢ :Lp|:r?c#`RS{αlŰG>3)sZl2'I2`6~79T`j3]~jw>nx7*\ZπNҪ܌.ERK~q/VH(t]s`îCoS9l5 S)jVG3]Xn,,;9=@65.r5Ɂ,22#Esk0fE@;Hͥ᝘.o]>7{nw^p Sy(1ۛщ#Ҟ\C?|KjŪ8iH$Jpiz#oqX CRkn1}j4k!3JRW~+ |e|\2c' Ė俺8'`ҧ`U Q 3SzyvUh/*@7^w7 ?kXNdZ,MÉ{)+0Ӳ>;dj^ !@6opQ(MB͋p8%T<m\sX2ӣ/#=xɬ]`2`dpDA[gZ9N].2&:an&DGn{z%#2p3c?⨛#EIm&&~LdM,Y|r:1[xoBaR -=ӽ4K)U$Lro핲UA:dΓUNB^cj"i\Qq= _QIMQm=hB}@źP ٚìblb6X1ѧz|44䁎] Է>uS&aIԍHL , Mlq*|X Zx0 /uFE]emk={ՌxVm,l0I{N|1 gJr55ΐo^hLsA>aO}<&Ce"P2eV/Β~φKѓ~ƅ}!4GFȵPzMuCMTT_r :0fndnD9Й4Ukhs(""il}=voT˕~7G+֡[6\8zDxJ \OQ .hz:F>>Un[NHJ:&8lq_([]l^<[4뀺Z겏:E?dVy=aώ8=5&UFXb zZ_WG7 5"v`oD}|F)+>=z7A(T\9kl%USMLiqGcRi\;sAx96HT#9?1ю[23/ki"z۳Ψu֎.IsjBs2SnYFUT0@s<;n'K(ʨp.A^Ĥ#lnʄ7XJ~AbthNnb=' .rzQ^n ɛw}xiyHP"hT7-0Qn>;=鞚f/,k[0.p@[^Yaۮz0٩R^q.M21n$\\&Yo_ q)gBnyw*8 fl]m]+% 홿iŢʫ˾QR~ ÀcQLjd߭gxI2I%iT"RͭR1h/u2/@@v^#Ok~0u!CAƗ6sF~µ zIXnqt)ds{i+(]?4b]Au,Y?0-D(q rN" MF®Ij }{N g gYl$_9er`^"bDJ,N`tfA5f`RSB&z8`z` 1-4djN6%: ahjck$卄epDFH?d!zuI9@_bk?GzuuJRĪGEK75j,i!|һ$C @klRKzSk`!Y`lOdw'-WK;\ƩtSƪDPk.՘m0't`M +rᏺz Pp 0s#5 (9#7w.3vvG맬v;GcP3Zl~Mu9|oZ$|Rhp,B @ $J7FR9%P' A޴6f 1G\.<y|dl/q%u ,bLꛨ޷5'g<:;|,>H|CޭkÒO"Oy>-*wW2[* Z?,(Asnر A4\scFK =)3Fg% 4I-#4vcm@hRcna (#z[?ŅlrXC2>ON!j'VZbGn#M\z5 WܗoQԥ@3ÞKyO<]C *[}a_j~3E"rW  `^Ioi w6yChtq Q n v"Hc VVG$=|'sߪz_e{MNm'{;@]]^G&fw_2ޓϑ͚t/_wh?C^3Q0s SnyV $%]r_w%!,Y\ ,E,IlV[:~~#J6'޾Rd]Pyg}~MjAֹ~~mѩ; QcȝL؜hGϴO8€H*u#1Q̥Ts2dEI y⨘5v'G+o{K\EYĂӖQ<I4A4 ĕH2綰}G7ri'MnGrzU㖃4p8rE(pk& }Lh` $CXW;-A<:dmb O~ գg@K:;7n>3SPO_bb#8̧'`/ׂA`-Ğv.-> Iv<Kz"tAc2qG2\IdYÐuV\}qfbQMB#CǃB/%^( m|E x\'PK ƗU|+=Umh*DRv}'yLV䌄d%~ q;bb TB(+DdgL0gn"Ҁ ) QDQUX2'b+zUGH2;UaA|)uN|:rU"a^Vb@|#aY؟Q 񺺤iv/T}6?,E%q5C_ ݏfܐM6$Pq]hrBܟ죲=U@T梢]i hFjeb/a@딢Q$#;S md8CvTK/rF=v*'eNP^ )@Hh}q`~3q'!H0|ǃ^b||f+n`!Ho%q~D2w^=rlEIp]a)zL|D"V=^$=/ Mo9DHU:&0]l#2:y&'e,;>J>+ٺ;@iR괼^ry(h5rGq &{?Rײmlr^ ^.AFLddٹ{;v>0 2BOZI0>/»Ija '!s_G=VAӯ徏ox7[hohܤgZm&  @Nб.HmBuO{Lb{% A BFL;+v/Ƚ?gKPP ؅aPKLQ Čd`9o\7} 1Q$ AS+Իx$2]\1-a3bݬ%P7re @<]OdvqVI6bQW43QbeTo{@ng 3~ꜣpim֟xQu%lY#֓d a9ËԌfx,8"Х{Yl"w'i՛h'ZסOg+(A~C5 pʐ 7.n*IXcY#BDg(:-&ׁդ 2Pel;O%niʠoߔӅcCrTk~(NC$\)CQotj]ٚJkŒ_19}ZH&X%1|"Q `qN܀iDEb_  wd>t4CuL}P&o! x p')3Q!mHДhC>o3F9X! (NCY )=P AV}Q<b*>/,47BصȢdY𒱇$t 'wu|Kk #4tv5Nؘ[%#@Iuc|gL{JuZ@Rbsq]]Vx_AYo\NgZKV8<rY y՛{y΋4Ew^I|8FSݿrdρc xl*9JrO3ʷx)$U}h6TT &&/0ɀwg8~DBP'^\ \|VMLf}?q -]9x=J6icL_rYl\"bGq1l1m!Me I}ZE-A{"  -K~’X|h |\:;H~DU܆ bo)O0yЕ8@~ZHf.}aS,B>H> |%Д>Wg!1 $&GS4aUέ^斤1C٨:;NSk Z%ќdQ>fBUˋPN!#͟#~x [hN A R7С")*Jg^,MN#PH@SFVJmrXJQ=k{8f䭟G/"ŋ/D .֒Ѝ\ Q*i0$;@@ `"u}lX44!Q= ֛٣ca 7CHȐoD[a% iፐ9EХNx, 4*T[±y,z t*Ff4 ^mu?Ŗ˞V@T.RYÿ^X,)BH}SۈOPʖ]r 㤎o,*E*jRNʧ9^2x{Tv2[oñ@Z}v&!88bR݅ jW.ɌA?n(4SQ fGqd' ɘMkSp!~|LZ]cW'G\)>B ؅u~+FBElۨ>ÉeeۓG/!l{_cœl"|A`漓a$ڔYB*SO7brb2',+"X(2( =ifǐGHz{au7&%s tif`ʣ4찕"K=N)RF&AW>āwιiAaD쏇7GɊѐ\uL= l:H11j$'*88YR61U*dPa5Q&VBe,쇏+U1 E%!)=%dߵ+v ֭E.i3mJ=K,L:M"C[ n]Y7cUT}f=*B5%S+{@y~aV"J0X!b!L#-Q[vlb>1 @26yM6‹chW; Ӈjw%%8J+@V6hTXr)*s[&[V^}'ClvnZg_CV} .d`ʯf8f娤k4MGP7uL~TKEЀ0Bʸ*~cHIR?Y݄U6͞j9H^̿G G`JAH5G%WCo=Ͽd&3S-=O')2[f)_wm {O/ GDy4_fGMD^ V;)0ΛCd|cvLZILx-)L0"Zv5UwȐU/R "$ dҋd)k\rytG5X-)1`DGԚ*X㽤W-(qpw砣k|e$tj2춀0 %AcFy s>0I7K_pMX :?ʀҊӎڿ̰* gP/d-A餈u ćcP[Ʉ SH(]N I^C Ǯup xI v?Nͦx| fĒyȘG6'SEheCnI5j; z>Jڭtrƻ ng͟+Jdo4վ5D7|ORWw\ǝ@ 8˺zJ\F᲌`SIP.&+jj!k@);V{Y*B sCb-Juz{~pzI:LCH&)` mrS9.mNЂlK q YSZIe}]6٭HDbZS8AMoE2@|)ChaLزBnYB1A#f3l"@?dH%0\DBD g5gf wBPyb2/JuԿsm}ڞ:=Fu~bqUDm80Nw8V"v]\ }8Ϛy|^n!If-jxW] w^"hNo=(c/*_=Лhw\exW(jKRr¿m&l9 ^ C-Lǖt'. 1rs[ZX(` %R%`X`;jg'̇ƹ1x?eý .YBaݚu1`y<(4 |2es{t=8DɊV eď蚉H 8i3lY [E(i-eF׷{$!DA0U?t6h>Tu)gL_ &r&"kZʵ> r87hTp lErӗO/a1 VV!$-淰6/sCg'i6o+܎m tAf\څB8r (@0^B/,mn\%q;1[t[۹~(wcƖ/:E.V.uqgSc|ѳL S%" E*PX"J=ItyxҐMv>Kgtj´zz u{mv v1ĂoŢgL_e =N ӡ y9$Wz^Bqԫ1DŮ %r\JⲴ6SxȀ]`p#߬lfRey3Lڲdvkb 9:JM.kH0rMܩUkM抁is 8:(sx V4iDȘRφ~V=d'pp$r'e DHN'7Rq8g'YV{VmykW} vbEm')l*W(Ԯh2A ԉ?+"p'q B];=A,uBڈeX׏kQ %&ޑoԢ>^p~[22?U=]5b}_<س-=8Ƽ`Fwi¤R}e8>|YjQ]k*A[8&@TxkE}$Jfڊ?"ۙ]fb(9"OgygNAx$wEU&U AI;_$ueHi $'ڀ4YF'$Ki7W9~睠7G9*&\*/ D'vb U"EME G;M鸫0|EYs&CV|5AG=59Kp’U26ems|.M]~7lZ"\[F@i['E~aBR/A*cRrZ芞 b?]eJ?]kZao߾1g6-I3|~[6R/lDv<RJ52m%P3|!1vE͑7}Ԗp_ M$*=pO@rjQ81$n_(#IqzF/[s=FTKi4t~Mt @1vo3<= u8)_=NondD /[yVλ(͜-hEV1l*m0aiTN1yp?Fˬ?>[e]pr,-t~G7V]2k+Ϧpb+:| &=i 'iɖF Ihgg8UXYD1sDtRZlR/H~jdq8ҟ ]ӷ8[M eg=&vsg7>&S<-ݱ /[8pZhsL2q'ȝ~pVqL8%+ڂ$SY,j:]Imuqz+,X]81"%ROmJnrt[!nޔcC:i^6y4x .جۅ;:;\[ Nultf~nE݉J.N=8Pz`LBbcg p)\mNB&< B8RR.eu+A4$ 2PaTxZ-a̓+U8a]Q4] aU$0%!(Cp+ jEDԱQb-y.?8fO'e~Їyx:g=qR6|1Q8U '$@ʾ7Zy`E51g`M# +آ6-lTld]~ |CE9 Q|dڑevf07 ?#vq%|ĩ6.[zXuoܦJthϺZM0~eXh1"У.gS(n`.B-ðgFZ1ok) FƢ`i.Ž*-Ns!If˵H+Ы:IUvehҎ_ު:f$CF nEir{Szсh!L$)3il3+Wu26adZQ#z.X;L|X^y"( 5x)F|_?g>y_k#DZ:hbPXA*B]?Fh\(^3յ(Bha}7f}rTH6 Hq<:&RKD_ ՠx 5o;*٦ to=og(h|!fOŠTՀ%_/e~.[fwcn]0ۆWG0 Bޙn9HfPlHoHN{ m:{.U/  L?Gm%1kXK{"Ep`WVI!SbE@@!Ǝ6QFJQp?0ec䛆5֩C4xq)\nK.8AM,y~6YI )`ZJ,kݖG{#Rd wI0uJʝΨmPtO*.|x۲=/JC AV([z{. aY@.D2kur im -:=6my2::y4<Э!=(z"Eݱ"UBn0] (8uMHh9 }4(J2YQ]6Msy0fX*L;TJ7f_Rt F&#;^{֗fP?_A[)z}AM`Хs5UƊ"w`x.tC5d&q)ӳ eB 8D UVkѱd@8}g&a꽮@ZF%`#DDDbB^I\$D^p$,~5@K=fw;NwYp?C1:EoxlzT]h!p?u ˪YX4aY<8ehAQE3CzfdsMLC=zL-V<#yro?aTY:9UFm S;yQk 6f&iLi%1$wȭYUN)hjY/כ8n{*`}0 P$A9=0oՈ!&%şk]'2-Op\Obyflфtߑⰼ*($BOSCJ0 M #0&Ѿ7eh0U0T^: $S to55$ CW2!ɸ_8PhЅa)R6%).#vЁG1/` $CУ21xhF`(a> 'fG6qs!în/(QUsV| M .`~PFadkacOKC Gӏ2|H|iשyq3pVFk7d` 7klOT$P4+ИYT6Dׇsy$q(HJАup߾(_4ؗ)";U%۹ HSJ 0Bz$ ]@* <*!2&q/eNҍ*>#A0ڳ$!+fV[%*,vN.%`ZU׈"K7,>\47a~ }n`f,Ib b#S!_~`2f -=i6NQ*{ÁR ?gPʪ x$2+V/oCp+OyP0L\ OQq$M/r1˚\8PA%HQ!9Tg;Sϰi|vo/€Sh2c?[WD:7mKmwΨ sxyRdwҴz8@u=!/bmbٳA_t-0@\BQ((g+"G3c.Ph]wv#~]U&TrJH7jBH 썕[XA* [ 6Lf.At,/?BϽMP!<1mw "̠c1|Lى)⇱P;I9ν Xu5+,D<# 0:xIY=_E)U(ǴphJkL-O[=/z.>pEs2*D~rDG{KKloGTQKv#6a&^{3ҐH'rN3ݹqFBߦ9D/>?XFt-'z6D*Dy֢C $= \KAK[G1"5ZpB#H!À 's/(t&) pHxhس" ~r-w^Kx=n)8ax*/yFc:#)ŷQ &p96NBtԄډ|^! (DX@lsq9d'doJdK٠Ւ qE ί;r:c2c݃i@:Ƨ ! @˂t౛ζUyvRJ(DnF~`7 BzϠ, Dzuw?(˧("폻0 &"FA*8l0^$g^jx_vqUlȖ^!WTDOJ|fҗҋ/0a:&n[-r}ˬ4m(ß@ x 3#s:B2~]%{(0I"4UڎfMd gYJԼsMY?obE*ػP]Tġw 6h[ڠ^Zs8v#H1v-q侇:-5 (u3pua3SwP7gMJyGܳQ\9U!$w$I\aڮ0ɋ|]3 8 3]^3D]Ѐ6$ +{4wƁ` Ў8?q|1zqS!q>Ab23&w;F~GOD<H7uޕf ǂ,5RVR_F{Ir.B Z͍mxͶK)33FSC$eosk{%S}B a$ݢ5o5d/gq^gP2u^DVMl2T\@N Y&A8_m8""jajٿ?sڪ6lFFߺ&qxxx%x7#:5S4FY[eW0/ )XVOBǭ֗1^"7<]a6K򪴦L-lwԂ#} )N21W F3,I1DQ6XuBHnu)$jM$szd~~tm}{ ov۵Hw--#yO]L=f0AѺYv}%HIsg74vOMiq麼(j@ɪ7!s\-/!"O?Cg™umdkC2,Cy)AJ~ս|XM^(CO 0Ml buDZf>gnu*d'. Ɗ*|ȩ66u7ו˖8FPZR$-]4Z?Vk83d-\@f`~)NS%b٭/ {00i7Dbbɤbm뵦tkrD>:fN&Ae0D0W{Re+qՋnZL:偦%3V E>Ԫ©)ۂ1W}+f*JRUFN (c%()HE *{h""̓̓+$ Jh1 z@=ԮWwJP\;N[d(EY<|EMU8SyݶzplxcLs%j9)J<%-6W(Rn(3q'Nq4qΙ䣄-OjFDzze0͗5ݧwuO8k0@m݁.6 U{0P8ͧ;I~ER)A@(:Wa :g(q31W $I밥@PaiޙֺDt&Rº5:ԜmFXS::p'."ٹi@]PW3)*r[N:xM !fvJ6 eSt, (2TyP9ךњx& ʪ%0ɁJ@`%)@RA@,"]95Ƽ$5(6m"\jʠ. IJJP\ĩJwDtTAt* *s>5AT<~#}œK#D@LMe_kfq&6-fˡf<pMzZ˄,M42m7ۆ-,ܛ{] ]\mƖq!yb̆+[EVL;Ռ6h.sY< ,3qVDv%XXƶAJxAAK% JQ@S)n"/l{'ʬ5B9؛pqe&.|TqnQz@~12}S0aYd8<Д,3ljsq`H1亖aԳKBE99#;ĤN+/%3mMPbC ~(AfTn*"XXM!NDhKY,nhR} x]Eݧ5}cʳg60C*Xpy2$׼QfVUxIchswC@:ν!B,!4N,(9Ȋ FnXoԖʕAJRJdOG*f X* qϫ9Is%H-0@ WNeGŊ坙YҸߖ $7:ݭ쓎lЎ"3$m2# {|SMn)؜3{(_xaT>e’dRB?0emn PtvJ0kqmRPo (QU(#yJ52>phNT{H=(Ègj"+ꢽ۳|TS~ـ<@ ч z‼h@=WEwG5mXX]HZB2@Hg|- ćELWӽ-yTm b(sj}I"qDPǼnP_E(WH? ;9t+ψ ?vD/ͷ_ޞyzw` ז,m`#UT I +TuFƥJQ ɯ@ GR'B!b(@gO§fق4@d.7Eo^Ikghsi:zY8K` E|+@=璣\ 5Lr!$ {Y{0fe >ڔa+xd@wO%AxIH~G)OkT_ D99Dοc81U- i'6{ymgmP>ѡ՞-~mreCƺ30lӛ7r:gQz|\ qϐLq~66r^rai!_U^= B h@LwY}ASٱ w(z} 84ȧ[o">b?D݈omɭ㷷m ;7.+mRx cm~~>ت[nF 2 */I!E#IblXll$-0 UhD?(*g[@qM:脀*|- pvHP& lK/:jd$ #p_z $s1W_ԡ/6;Q[DWDݖGs7A:k{%wz8# 'ZM J:8^k"_b# $Tqxd^|DV!~)!C.|U:GjnWMq8K~.y83 U?}Jv7N^e%hs$`"BoɈH J; w1i+mnh֐!˳b9}ٛh3=e5߬ϝK>#%ćoy w\]ǫTn` ps,߈Ȩyh\1 w>- L%%Y@a-3c?;+^hgy;+'P7"(kMwMs8ݕbSάv 0O?H$CTNᜊ](N9 -?Yine%Fa27o[o|˦&–:6ŻR¦it@ ͣ,$qWչ9^-ܟKe~=u'̅pq s3ʴVvnjPRQ< k[6p^KݥL%6dk=3H #8@ۊNV ! ۖV)Rg9%P;sߢ(eGߺ˟5A' v$^lzo_ܣBrW;@᳇v w?._5Rw>dΔ2TaÂXnCC*i>U(J*HCT۫>M>8㹚=К;Y&PQ MqG]CЯOw?/}E/"Խ A.)~1>4@񰬔OO `_~X ɿq;roٗdJǮs,iud?{vXR -0#T)h5(($&B(@U~:՛Hlfwoq ^ED &C+@)83S#Uq$jCP@It-wxNsB ]flm5jl\haZZڥ2*g/?1nG~yl6B G:[@#~*H  FB($F  NQIN4t2-&e7_)  E:?ꎷ}/s:O=i@UypwD/Ǻ?g:FH8 _ }V†:ϩyk,[wv0knNoS(0b/*(,UFKg4 \!X13by6yxtRa=H77PSl7OEd;6 {w-0Jife~3A^u^pNQVƛK W[cN󘷕6mɵXON ]=喔5 *z}^{eM ;6ԯ}bz-5s^'Ol{V FRٶauDoA.|U};E׶\nuOԸN3\l*l k-U\\+S']}V[ޡ{krT< Ѽ]D{8:6#;0.R?^m$0}S͓鵮 yWOے!'_u5fCʭugүXE՘iM-xZ:}\m%:V;pB\.W?=m{{:\I/BEIvQTEOƊ&xG>P:h ({~ƕD)b߂^#{!Y (}H("EC0TS"T2#ɀa0 t@wMx0 Hx^nE j2)_jɉpci%,)0s9mc3T{qUH&DG6##VY4adŎsۿLgSǍ {u'F ĺJʧbp9=2.phhRI\eհ>z-^)(AM0a:eSNzCCX$,сcѮ:~nцށ*mH Ȑ3:^*t6t`)΃ |H"yH*P{Q:Zt1d`O^=$4*it7ݍ(̥Qj(@҈k]x & X2l9֡GV)t@;"n@ك":+E@{Br*[T*(j D K+.dTm Ԩs \PoLɫHfZ1{0P΂t)RD&Pm DЏaLfH`H!F@WEޖ=f~[8)C8N IA`(HIUYy)!&**AX(r@~wҨuƊ{*<}&lUdB@EP$ EIׅ@S;oxŠ(v`wv(omh-D;X̒(}?[\+#"B2 ,ݱEH ׻'Cİ.y~UC!6ܶn=;MnQ@kEG,PȯJTDP@Y%IE,o(I`((WWCC`5 'W:( I$:2@"X ,2 AH( (,HzOɡ$=K} &YJmQRx:Ó;aΈH H2.1BDT?`êH c iZ/vs"N h "H$Ȋix$u ;\uׇ Snɔ +\o2 J `HȣQϤ[I$EYS:-CW,wͽ]q6''y\ `HQCJ#hHH+ *QIg]߰ҡdq$_J#tC_HA΃z'tu{adP_iwcCeAj,@HB*5gYe\Z8BCO) 4Q`BԝfXIAWP1:li;K0RP0ý{[hY;$̨&``&EQ @6[Ŭ30If`yb6+Bar8H72`7u&"#Nf>{{ẅ́OOk\.8'Y3n)E3bƇQ_`br"Jvw:9:VPT"*3kZɇp/"(;ٹ=3ὀq̷2 bVMJ즤^{J=o* (.cu) ͮNè̺&&X1vvk$Z ̺5p|"R96d@^>Ьav\vzm}ΚgS_T'&^ߟvu4j׈o5-k۵NTN C7tnXحKR8Ό6Rd@tf^nA@:͋;AQsh[D]**@,vslֽ!3fBȆ&m/kki۔r9r8Xx͜A ` mJ,o麜ژ~LƼt+""i_zԆmO#GfB/rF*19mw<_"fPp@n^ +!=23xne\,'=.}ku.V[ ޛ~ӫnY+'sΡWW{,* /a2\mX9mlGSNr{- H07y8;ψAC͹^Gu K=E7;3tʄrއXќKq-NF(u4R{?mSyn;U vtGHH0LI R{ToᚬgQ5q6XM0;rQ=@SocK7e~؝J#ł+Q XV-=bmJm0Qq]Ah\V9]\UulsTE0d;L+͍ s7k-c}*TmZP4EB^n+sqCB6A玸$"6Bm{c s>Ftv"52D h8,NXqul[2RqpGӤ@`W;a7aYTmIdzWˮL;tj6Ս>Xh(C?pvwuy;R81cèd ] Kk̭Y aL )@h]H#n IEE`ӚIz|dT"ۤ$G-r ּ?57ـK5z`ɵ3 "𪇏4^wo5oW9 LIn!#s6i)!Z 7!6CJ Cb}ab`=8++lhݼb6#%Kcn͙SSPT\aaSA˗Msa<!a-%#e2Bg@= td㻯%_00NRE!H?ʴ!^ EN5 01i\h$kLb!t!˅dkev)/L*f@NNu:;;^LΪ{]{ry|ގX4zW}UG3-*:3tE/ڜ.s׼u7FuÙDc$ V(ɤK,5 Jcl]6%I7Nҷ jm.fsWƨSWy翚 + Gt^=:vߣXjr(Z}&"AU (zo}.r1 a?a|w q"#dRwXaiAI# WNߋhE& _M4PJW6v_ ry+0Tb=- MEu&)[lL:^LV[7 W7$ us)‰ k96H,◅1Ǔ3eቛ8hlٔʮ& rkp$3t 0cMY,Dyz` qwİop80Q$x)YSmm~a\Oka^[Hj*HU۵Wk"V Ky`dB\)i!2c&D,tz- :8m;d]xXs,q,4du^ g4 akH{֖8[vQf:Xa`,St2Hf ;zͷ  h l˷[\&n quk9l@jd P v8q6xՎ6z|n&/s0C[ g]4XA)l8I*Ys ِ K;Pۅ@v麐StP W( Țp WvڅRx JibC0&0lڕEDD KA$I^\q㞾!APATyxi]6w-G aB$[Ƅ4&I",i5);]a ŧo"$t$ 9g\R @:gZ'KLs[mmr Ԩa +XX,G2帴U21t:ޖ dIMM.9GGiGk f80MHKb"V5^Z<㖌w? (IFIfl Lͦ;rRC(ʞN95 ŢU`$ f]" C4Iŧgg{qè ! ТrVt U/i6w9!vS]U'%&&w yƬ%B9EȉA+ErH]rEf խ8 iK)!' W *Ԉ Nޥx 0݆҇J `Yt>>MȽCL%9A%qG(zViBK'0%{k4>m0n_%a|! )nJ@z#)Ayw- #F uR)W+(jZFuCrd˽Td7/aКR { vX+ȶg%N^-5[!$'',9Ҙ Y\vGkLQ6xyZS%C,ܸB@ᰐ&-,I0տL6IP@:_V& 0ghgZ(}#1vKI8 u[>?<<2 Ƽ xx2U7W6%*'c!P 1h%&((.jmV)cKs_>(j\<- a{<W#AyT s WF-alFP۱wzIe#f "O[;:iջ4)eJI 4"$ǁ}ӛBr0)NG Rʸ a ='K&nX;1a.Q0Z9@H"BiwG_iZPY1sy#[r, m>!i<iLx;QaV"}0aͶX 2@~C)3np I͑enmFY$02bA7DmX-Yȶ0,rAQ IX @fi,[DgʀʹQUϻCo" .l0˷O-˜>Teė")@(ZE3j Bn[vvAӰ;1-5 Kk0uFXNh,b[*``tkdƴtO(Jx% ir,%!ă@c |4Q){v&"bS Mh/,ktstÁWBeVCYλx2 ĠH V["Ra=CXfdZ,@}nQZeԓWDT 5-j1Ec #PR"DͷӞRؔɔ kdvD4 jЂѶʴP-:Es!vz!qzgq#evk ySXl|Q(˳*MJۇl{nV,Z׹yH@M=r״hg8b>7~,~ɫi3V5mޭoC"cr޿xp7m|#%z` Y۱UOt5#Muu88S֍ͯBk}WV6ǩ;7Zd_"fk?N7m;*<$'gO6{"o6mNGkzV,~/FNe{'-bZke+!۟zs WeEFw^/% ~ÍYx:U!<{++n'+T sO"7x>oO zZPx[WB?Qټg05Fw?EHz^r֮GK?=3{^f4n7w7)&TY㺟oTϧ>jkw$qlxtX:m|KDŽ+ѽ>te5Mx8]kEh=M}Z>bcKX; `@[$Ӟ77D#DO9`P2q? Q1L]sRF1dipUKvc7L9&Aacɕ+yCGsS;.֯C};o{s[417"_oE7~\_ Pt Ht`CdZڢqm+jZYm lPJdϘ  ~; *@M(V I ׬1*WYtt"曍2ڶ¡ٌ(B▵lm EJM&*:ikJmmVRhQ[l]khb4\1-m[` b%ehխmEqKTZZ˒UkLDNB6Eki\¹Vk.2muha:cQV1-Zq3-eE U+D4Fʢ5q\˚*Zȱljiqֱ+k030 6eafQƭ5ffj5nTr)mhukֲjpBrF-V`94̮fe*KkhhfJˆ+Kk -Q+[4LӘ:)\J")mVj(5ni)Tn0f#t*lk**0C-nS1kU3ZVu2Mf6:dEepEI MU:#\@Ƃ~,G@/AAC.dUEN 5(&XiEPx (+ + T̂z!pqGC-ֵ{ZYUу /Du|dU=d J@ܨ( Z~ EApPQ*| [ @@rP0T91_Kgα{Zop nI1hd ~fEp]4[W6.uRbtEj3f"|w2z~f=cݸ"lm0۪!μj1褈,dݎ)PgP8&ٺRDwC !o1æ[sdE+' njmƻ`K浒h\Q7wCaP $ِȈQS2*@Wn '@A9`tE C- Iz;r2$x-Cd3,poEBAQmĀtU\1Q (hrun  @XĀgD GF"ED-nH!`egC>}O (Ybsde8qT =rO 8HO!s XVW#KP=n/Y󖭧^S*l%v-ɲV:AIHwTCd7W,1철@z_ K`tJ Cp^eP=%{MCM8 e!b(HwцdUwG x݇?SM]~7lP}aXJ@J* `s' (#QTL 6 􊮜6c_pZgaהlӭqˑ|s2] @XrYb-e( _0";A"+Q!Ða am->c` ⠂OIE 4^ʄ P.@:d*2LTv^ֲ@?)<^<(;XgE:x ΉAC`ӭyuy.M]zzDJʳ!GLKLmkZhy$k;u'ZMC|:;́m& Mqgݝ+5)iVLL\~.2l$  ']OK}` $$Y#+ Ϧ@9U)L1 $$_g^TDSZ Q;)6fMXʙS*6U$Smګ?bfþiTs&/&E }ob.DνH&3|P#H7bHc}ff`8G,`itM:a6;&mAŚO_Q2yZ2(-I1&jfri͌ԐH!h"dFM Eͻ!!-Q{(KMXP=t~*>B uhGv$PU%DvKE_]WܛYi&}y\,}<1T,Fr ΁=c![^YT6yEd 0( >Ґ7H6B@CN[$kr}UͶfZ%s֦ lan.ֱuiPB,WפTmPݒc PćTݗg9`qsU1+3)7IRC!"9@ǚ{?p&q{U@zdG:l0ұo +B X> T_O}5ٳ]9ow}3IpCs^MmVuc圵9a 2T80\YBa9~eiuh2J_8_]s@k{NRn^CR)t9pA8zq/j8xPNS,T7iq]ەnAClRvch[LN#$! ]DAЉnypXUDXB+ENv䆫,/$hE$s'8I*X~FE,sfftzB@loA4"hFɢ^Wƺ[QFWy{ϪۓVDE!P#I^CZED3? bsn$aQEd#t;*oCWl̀42T^iXnt !  `y:7o)̂u5"b:_"M6d&y]دrnCJye2VJȰL28DHhqȟfpTKx,'WUd 1M\ ".dR}:LEkuvld1?o v!zK!O䄚S vo*ԛ2UH@eRRZV(Nl=C=WRkHȩuzc) i6"=Z|s~ ➊u]VVLyoxx l6Ji5QSML , @ ,CB&qVU}Z_¦Γr>!M%`XCd&$?6"dP!Ӫ.Nd𷽝ߊR!j6ρHC2xP?-姚>a²CJuQ\Op\̿c/0Ţ\ͳۑGWfkw/S| S !n".A &!p6@CjwIɇgvaW-v7Z]mpiv쁶E1 ]kYonbmK!+n5d2b hT{y1:刅@N]GĽht&*=x0~! rG89 G]˹|P@fA.b<ށZ*}09i&e fh^ kU-1Ƴ(4>ޅ ':== Keyz U~fjmf=TVTR$ Sg`_/^*, gIzcU&l^])4؃ I.I`GMbVXzkE"%1982١&oL׹ uRv m0#D;[sR(iYD0HC%q&#~)I5By;yO#O]jŽ8|O 6qعCz ()`lƉiH͊D0(E)J ST(!M!}:Qm:16#tahdT?"ćt!GC;;/oz|*OS8s[\ضm{g*&/YT^Ҡm.</k_xyߐ-fSn:H0 "Bk7˺ffv*oudBF!f PK*碙kȭLL~f* |HTO)zﯯkǠ؊:gC6[^grTNTmMH`^%72"y~М$$he <͜ aC7@]ȋ C $IRmWs%֊Ŷiyَ2ZҕDm1( (^9p5y\/;<]ei*;\G YBM ,k^_c'6D⭅vl|cu&.z1j|{9Eh )M,Z}fZ|zcF|mUնg9 «!#J3\i|[H o9LS9yDZU_eKį:C6d{-nIaVXic`d/Bsnb#?ÇpK h (ttyϓΟ.&.+nq3]ׯqSnty)Hpvsk*p0{F28 z*AZ\jmB( =PpdH!zV&/?p Wp~c5Kx(xX(avPQzу2|3/V H/yoGq_upς|I'39քSJʠ+rtos{k.Qv-:T3aa}B~T23C)8a$ma<8,ЈY2YS]IYfcb4I#*M_IͿ mEupQrR'c9[ki)m0^}:{<:@@?J@!T &)5 aj76ݯak]ϼ. cf?O#FN^GF#)$60YK+ 6TD,w4x4.dv8&N4K V >oJOhTs{Ct!؇$ F5'c8e瘕j:] #E?v6{U'e'e:#nPYk42Al{Qn}a3,+g\G!fQh`Pm_Od=3\r^ϩfytwotSe~G"3lordF߹hw!<<t1׳￟x_;14aBbJ (*AKPV)OHboK!J5$Tr²gey5'utSV( Mn=A¨2tc( /;l.k\*=¿EXZ=fEFm]\c'^Nvxy?5an_^ש:n|cz#Nza5y0To cy?.w;I7Yh=;"J>n8 I(KtvnwIhv]*ϯbn~=s@mLsoC.Q ŞԪI c_\F yݧFx0^QJp[QywFe>u_#Oǝ'l}'W#f>~3_6|0'fG$u_loUm5k|: i foBN\Gv: Ez]~ڴ'x2۶Q6iϒɒ6E/ME E5cUxYG\p|K/w3?C|UT?L}/&UΎ|Knxo I8%ӟd\ J9g\7g^=Q@QGT-^)8XruG` A (yy!)D,_~_of=.џHor̛K'if9 (IRuˬi?_\0g}.g+n_vL69ECگ^zt2ֳCo"f_Pl>M Z^6ZoParG-wT/>6 kU͒!"eWwF!ULg+6>:f5ăt}D9w,S#җq;®b6Geex'H/ Du=?(E)/banٔQdR;8cAϿ-#xC;G)܆VBLq6l+$p2}T\bIW3N˩+jO_"|u +d,v Lo_S(V{ꊗQxw6J*玁o(KS;Pq$\A),}*kaɍ` BQ?>`C=4"Į&22RZw+sUH0Ŝ_lLkm n\*YÊYgLwPCvoN HzrGD6ݪҾ0öDڑmo xP[CcU^S?2 $P+=l\ikqvtݭx/1՝ۜD֋TZ~lN^INE %6> klnj6EMXxiM@@@IA` $  10H H0 "AB$!vkP=?|0.04Wyqd :Uٻ[4Fu"PǏKe c$.|De$CSk-=_y1rj[_iwc;[;!rUXjWvxإU -yeIXS'UsZ7ICVUaˁaC()e (F3A+"D a$GB{׋@ۂdw~t6 .n] Z"<2X{U~qqsR!Gm0Po!(!@aW٥WJ3h_)-&Ϋ`VwN_ a(p=2Q1 9˭+h%bhmQHNJD0 '.ArEv< $ NTRCS¡tm |hMeԥEshFKA)Ό_BqHw^p% lX3b.@%sr?nx6u]уؽv 85CzdgK*ٲbnQ-؃'9¢*=sBgn7,KZjD<0"Sܽ;程*i:W'qep#ވ)7zZ7h]Dg(mܤ_Me1\)+D~cpLŖ3%9J'cVe>׸4f~LN!,5b.lo -2ke+(Tݻ otY: lYa=ZE2Q╘VII.jx89œ{7}E-RLyHQk6C{SOczW]iM¨RA'S\ߪ>":=yGw]_LH1Ďs i!0 !@-G=2L"PnTh!IW9=֊<6;A-x( AOЭ M hY^CFGm|Gy"A SZ ]fBV2 =ȵӴqҴVV%lc{fHD(d\1,$kE1`-C.U̠Ӄwh Um2uD+!aNfPOmcSdxȺjM Ȱ?\Ԅ+|'GgqJBنwL&1٪먪)%7Wp}a<,ci9~M[l.\v`=fHy,;"Qs`^NKAwER QFoL\2|Ogξ730t z*Ԧ\ D7P|XcJyXp6gTs@:ӨZ vCr[m6(v-[09lEŹGEVmaD(F"Tr[hvۇh1Cf3Ͳ.r$f`=jȻ3HrEy6B_ Ih疴),T\źU }O!(+"rEy9#6 Vcd͹p@3s0Oo%q<8)>E;Ed5ot& ,A snaʢW5H\%U4=ſCZ+)Va;ԇ]Bw_Wdv÷'-k}j8c='y3N hD5 |vRˀ {" 5)ͤ`XYf;Kq<;1I#`H!-- :5 JFb<@RmEƚB̽j2!0/)=Jʃqd@d"MEĒ;۹ e'G.m]x6/=WaShC1p`pCO`t+ ]""hh4 8:.7a6WTL,E`kfwٴ٧@9fh rJL"8B8]Xe&͖-C%Ac a\MO\Ϫ^[G"֎<尯66!^CH3Uorؖ䰂l_^\p;F<^*`)^}]GiE6L%qA\Xhw wb= ; R T nN;Fz}TRPKr/%V $`j;iS {:PEA^C,a 6hI!>!NYa⻽5݁r-x YAtS .̂ eN8/P4'z[e# 鴄(5ZРt NG l(⮦_.P.A C;Q@ uR.$ ֪'o; v,L=eOWn`ˉl1׏d6 dW^gBUbhIF Ar|̐8P@ , ®̓C"V@VFBV1BE (DU1/Dgua ꀈȉXƒM, &0?O I`RS}aw ܶ[D,Y^ޚϖc4ϫz}/dv:äߝ/?Î!| v,,ƱYD~smϓ$8FqKO8 =$LB n08dIpMjie~!Pb=*~jtFxg`DjQ[(-P',Ņ%f{i*X 4@#&S\y=zJH^Mo3h0uΌkƲ, Jťԛttax(y6 =äDĖE:i4}>:ظݍ^}{wZ ͦ{fѠ=EV=Z\(r.&PFɢ,!@'1V؝Q`Xg8]xw.k]fƪێ 0"L=y67z9eo䅕)/y7 Ət>ԗs!(ShM!犂T+WMXk&$@X+E0#keCv1h@py 5 R: Y8rp" lp^6&)N_ju<tt&Ov/̞9& ^tNM& LtЩ~IJĀHY/kHK=|(}%Gs=e+$eІ`+ς ۚPLP'їybMnD!rICþJi{,2uVZXoPaP 8)ޣUh, D" V o*0fcsn6^WbNlB #sUa+z0+l %rӄ}€,ƉUKN3a6bne_Ą]o6_S'() 7|KXDBI`A?D@N1_K!rr2K͂7  cBRf G?sAs50oJ8R,FOnBXWj[e ЖnF%w|r%2&-Db4URv0XuKv_19mbZy57G?{|<\iXACWY{xk x=у +*Z$I h]5͆E fRA^ %1XYQiVU3Z-!?_ ^x8 ]ƗǷm%!e\֠U/'287fL7);v)n"ͽ- m*{jU6c)DRw 4Iuh5D=O5Py΋ xB5+Q{>maIwAAu\Bg|tVU7>Tk#{+JpǒWgHkmUTnO?.`lĂ>3nQtٳH; jVOsi)0BxjEn_u[WPy ?s!k{ @">YK޶~xA1 ;J21BYW ZfPkQ>3(ptzy*w\7ԢH$*EGK󜴴6dbBQQe:yToRq-=zpl1De ^c4dyivBnCp,a0plKwM%4w_;8Ƭ!K/]tV|}`hj0nZg* gWN&H{=!Bp\1Auۍ#TJVy<z7Q 5n߾`TߠU* roò\b族Φk<[|JVB,c=ɛ\w!=+ J/NX] "9Q[:n8}Ef.%U 3l% "&J(YX1ab d"AG!eC *h |ͬr;! Q8d߷ynIƭBSzO46 pm]8IS*e[(Jm濐^\+ŞTҧ(ѮuV >,&"Ƶ`zwem8j Pl)`~?ҾZ5e޿sApOr#I(0|dY@R/ؓ{ͷ/ gЃw" pxup% ꂎn:kjKkM<ʼn͵ts8k2i)xV'`]|p8Dœv4S Ntg A1_Az+kYxqȪ2)䳄[eR09}[|].j))\L9Q1Z&zX)V&Rr* ٧ Ka\SW2&=+>iFtrHf3Z=-fW_}`Pȍ <6; (v9[sXN,jjT*ωנaa]kCᐍ}s7qEӈFB™' KJS{ teBhA?lxök{mĞ6OgGʸ.>Qȼۆy!%mŹrA {v],!7@ i9YP8Wdk5~[['ŽJ;8z6j'9ep;5$>^V+gEhXk2sO*>d.Ѕlؗf;NC.˵NEܝpkfTkִVwOsDU::\ۘMk9)2|I$3@6u*2B- a>VvBsF Uo{|-u&=Q~I$VA"Z׾=Z4;XSZ2v !1a;P,jfIZoXAMi&X}sG3v-7;;GЊ ۻr ]9Gξ<N6k!ciZPE B֠=&׏z-R%\A wo*.EzSl-&t~6)isN~POltJԉJwaQg2Q Oe}:AHaLɚ,*L-ţgmTD\-vw*CbD^U6Dž֥+z6)7 Qi4Aw*GЎ5Fk˄ौ3PsIRn.HJB& h]k!a}vU *z8yZ ^ 3x mgB\f1@metw[M^EQ -kP(K O tCьu`u[QãAFI2t`v^ߗ25^aɏ{֫qy\9TbGϱ<N@-4AhOTJu03U0ܫ, %5ߢ\.# #Zc#Nߔ6ed``T>3v:ĈD彸o/eTKFuݝ= "Bd 'ND`"Y~u9$:HOgVq1 nHT;VO{y8{P4G dhjNjKޙD+nvZ3k3913fĴ<-~֍.߬@r#ddHv#Qն?O%ېkΫ>\5N\ƏjTo#M(WB=~d@6l_)ll{qN慩tfw];3&7___Rz)Czqҥsvc0-ƽjm^5zũ6 ;DUN)-1W1>H?O[ ~[Pc K49'&8PmsM*?k·Z|UllW4"fdRvr;%P!@" āXk%#g WQ/+7]xo2| yNS⧃m1x6lZl/XpL(t˫.d"N9M?1T:b^<-w.ڞ%Y٦;6wWchf6p9Ģ&N+c]>ts@鋍vs0d{WUet< ԥZ0弃$U g=ϹQ*(ŤTb /iARhK0$1?BFV0:M-{z3p:q־6$2Xut {67,nET?R67_w/l6˴ ̇{RnIsGM3SuinjRL%[#'~F i<0 }qVfJ\YOnOіɱst1wĜ ?bsan(nBu(wn/+m9b tţ.J }鿆mY}y'ѻo]htJkCZoKj]0 YI[kΤ ,6y]uIhPfPhFg N߬A2k]Gox$Y4\_2vy1x֖v[dȺˌMmRduRѨ%.c{*kaGp4lǻơ{#=| 3ѝ<%g2h]˸nuC_Vp9xpQ {n=sc$4߲ўe\虺83(`o%%&Ә\e]08^ ɠQCǢtd!&dY.J艕;CK퇮e#S~ѫ۷UfR ;&$x W˼TXQq- /QnAl~~GhQe^gNkay|Ee^vaa}FJ wgΖbGf;,JWrriiNj7wuDؒŐGw2 zLT,2W) :KdV X}@XJ4 ZL5 }kz<%s;,#fs)eZ(v%Xƀ8 X56 ۷+>~^ܗ2~ pgsڹub{\8 40;T|kYdCzW>P#>-sV!r7-FuS>noqn%Č!Iv2CdD@%bb@ Q8͆UK1Ex69x8mPnJF x=oŇon,g EWg+p{mY[h))XGTt Ew1bYV'r15B+SSrc@̦[cw~R2kLFlA"<aan%<[Ur ^I)@wk,8&߿YvU9Wڵ<(5UkuW0RK&۪qY1]%rrf7 @n߄Da٥ r4|'YCк,M{n~p?2X^ڪg~9fD%2Ղ{gtBhD.6ڡNxDjSw_隅I`JH:+fU(])-1c@JQ'_V/bx,Ba=X"aD=5l⏫'}j%ABTɋ{+G;{/\7y]ogB #a5T3|vx<{H].1 7K_:UpT7r/u_4txm q~ٹ И+$kJOd=?{%/ ͩ6C1+c(4|:kv[<'G|=3P='_;Qz;'e7(F{/h>wʴyF{uuZiE,џ:9/D0Y>ABɼkKmy8$>t'c8{`ܸWՅY;k\|ef/"hyOcۏۢg]6agݶtQQLv)#ʳ\)X @dسƚiD@ǖ0ˈ/{tq=.:}DLܥaR]`GeqR>:x'E_{p܋0πs!]QoҗSN^?:=s<=rs !X;Zk>yvz{ܶNZ78za5|.obtz(\xVW˸18r3%:Ӌ[2fM^M#6A]9^[XA8wY=i;u/1 Bw7Ě:iqv8Nԛ%)G5uj%MoݶsIMu׫gI8oj:NtK T6#hr Y%\_>d 1 74]/$N/GC70~ BP A":QtMjE* #!j3EAMF2QTQ!UhLj{xE?ߋ SL@|]h"/A?z1?zD 84W?˩9= gQEls"'J*^ i[o=^TD9P}Sf w\3`TLz)bA l@Ff tbހ?l69v83ixQ hPX!>N}"&M(ob#iAz5o@0Af"*A邎|@7"l^>8&m(< g9j ؠRE_Qb* y!5b)z 8vcɂ|_PP?*&R? #݅qi24r@ @ŤD3σ`"x {( t>2 >!:N*9b!xtyK"tvyԂU^SRE,ұa*U S @8D̀((a*"tT Cr">jhNR¯D`*qt`+DNI)}"𢈒()z# :rh-=v dž}=qPU^/vg=sKoK[jճI3=G6~I dPCnl5QA.h$IQZ5I_.9rnK>e}+TZ~MhVNxksC$͈ pb 4s^p'Eqe?RK@OsԼsw ax#.z|.<ڳXKlJ~vt tKqc_"#z:KDg:~'\#>ϓGf9c[d-Uc03TERgD=k\ J_1}9/xv̑֎&q^*,SP?Įbtvrm|O@˼x:VR-g(;}/;{,#j<mSӬme\NO)/l\G?;Y3cb*]61'RdpY8{rWґ{D B9~rͤ|2׼¬yX[Zm09GVw]=MU}[/Rm߄VfCcy'ph3[=xs z!ƕFW\Gb%`F~?}4,?Tf G;{|7ڌlsl3;[s<`>>̝8AmСAՊ; s FE4)X"ijR.dA2"&SITPDDV$EB"ʡ>*8H!FdQ挻tBjD)R]H҉ꃽ`Qq ˺PPAD&oWaZ&ԃSB?[j $Q=+"6꫉.fմd;K<n~;oy.-s%ū1T5;`n4+ \1}԰$6%tU*d콍ɫr YTXN4`3U_&| Qi?[:dݹD]HI}q,d&oJƣNWDŃA0#a3 p(|T, ±@X ,E]f!ݑzuQ 9w-F>dB'&ApH(U*#ӈ> )P!)3DMS`Tx؏o_ˊ+y6" 䮠.(JJ|@@ ? Ku "> (! E4 tb WAP^"``m@K 4|CyK {pQq> Cqouoގr1HY? 7{u_$o_'e O 4XJ6 \7wyWS嶅'-|h!%5a-7ȹīNv'uV;KCMS%4'/Wwb9669b嫋N+<-nW lHpڗ]2 z*~`ֿCO1_>< "B,Sbz@?9#S._rm#1=ܛ3C=}@NȽ+lS|[L!YIeo,?6{5-aB!fVn_eNȹOu]{zF1!ИVbÄ_][~c|Uf^5[v3:xEJ̅Y`iP y8G/ A1[-]|%zWER>*q r[z&08)Cݙe4ָf֍|EZ[]wUZD7]aOd(yTP{/M0U$ȠAH{d 1%C 4p@mhl-o3, 8|}VͷDxI6]yvC7 չ8&=[׶Ǟ-|W7e3Z{¶qj\?p02hyN$'վ෹om={fz=4Qq_n'O?V4f #c ?Q,֚ut})]j{%*G%[י@_dXB@Υ=; >$ƟyD˴q GΕW^J.u Tz3 N4qNױcF*fL +A1@uF9~tj +$]WQ:TΠ4hA!b[v3FE3I :$pE8 1"<':!-eIɝo\}7@5,.M8TH rA؈W}pT7Hd9@NA, }C..)D# E\115ĈV:+qZ( >dD9E|\A vN?DKO@N11Tz 0b `yM"_0@ pbш/-ʔ:_ ~tt௅ / v:0Gah7WxDAyDFey$EÏ6&LRVB5Ng7]nf;>9&U[qZܿb|8+^V(b2DA?  n-2kl!! C2(|t^YNX:*VyKUJ֚B.CJOwELw9!_xcRK<-1)QJݺhlZiSdb70`@CmeQeRʬ,9u gp?gnt $D&EPU=JIQL~O Ё>\94+P`w9Goݍ!븞 Р$3h6vd Yԟz,f,B;oT~l3; UU sgR!M%"SAE?#SEǂcj68KӀSE ^<'{oZ;^ r}i:/uAˋĸԯt^]<½tӡ.%" DmZ4̊OI =VPqvf}ϥz-U|pz^#wGm`z̫WXI34* *a~͗Tߘ}?+ˮi^PJ^XsU𜏹ȗ]m׾ 0α{|}wAۙ1=D}M ` &8e9YʍDi[uҴB8H&42)iEG" #y cՁ'ux2S\}AZmy)bmŊ^M*0cik+[SͧFU AD> pM7cdYJKe"KmW߉or6F] Ah:fܗ5Ɩ3@C(O>_yw Ɓ{TW'Q١ԝp0÷ZY"ge2O;?OΉ&°04!.? |/Z=nour#Y+kzx!H[t0 !cu2s]ho<|-MsOS](K/;P8r<_r=Al0)J`z~G ߍ}nz $cR_8nnZE.#(Ĝ}މ YJ_-wSW/Yj.0p=ݰPUZf d6J:%0Đ`֐|I%/&"Nd%Kwa:/%q*eN̫m/E]nek]%~%[ƺJ0L'ujUSm5ڍ\WKK' >٦(4HTƲF&Dǚ8x܀3;4Э`P@ԟ3Պ!/uexDǶaX ke\=묌cw;Nt˥BJB,DoAR7Pha0-mX5rw*Z>!Ea ht4P`3?n5F(e]\̀yv I Mvqg}t8k7.2x |:iO~k53:Bޫtȑk 3D ٪7-fL  gg[[YCz;_ir.r yPϘ9U<6R% :yL059YiՋe FbѦuc!_-gG(ڦ2) ,R,ԢBJ,GQ[s@g!zex&u5aGhE*ɢI{5R лٔ߈xŞ5?ے9/j-B5U7RJhW056) F)*eYqKRŔ5<-M1egfnd*]qf*V)ߒ (?"[ ZMej:U4]{0bJ'L0 ˟F8(r㍘VENC-Ua2U!YR(MeH٬JJL3%Ḟt/M8$qH)V i76a՗W;yłшD8tWV 8! p Yw~ÇMɤDͪ6s:Mui_+*~LxP0eeP yýtRѤuF֝|:ԡR#0$K3^騽 TS0(t"Ƃ s`eo7 /c ;fu0=h~צl1،qs7z=ݮb\q3h ?ɸk>,QeygU r3_m?Q)d<=,3t4?vٞߍV_oc\f/HMeKܩA<֎Da%{_坍QL̎$]X强S/v|&gii+<.4"Už&&wH@HHbȺ"0w>Xuaȵ8Ex7'Ugk+ u5# `,:u( >>=$Y i՟jzjvfӦomI"oSYӊǑݮ޼ ]y$7p-XksI$68 3k%]?/#܀0{Ώ>B00\W+͹kXju!AGu%(PJfTjS`E6%RسY>~./gEl֔W}b-I>Ili6CDF(I(t2_VKb42-\rEv0 wRIû3h78wo͆F+ʼn^D5{ּx"׮o҃ꨆ@48a/szjbcetȿk Bij=!Og9a O.ΤlԼtP olec: !7i{*YL6{wۋ]hn]ray!6YvW&[բFKJ@Jh6MOfHep:vQ 15iRYෳ0ǯ{P43 IX z3yvÕη<wra%BMfK/Z,p]кطO FA&dQѝ Uo?|޴} WH)q0qT_w}]B1ĕ~+HPyG[L'RKƄxcMv%S I=Y3dT< U햖trg&@"1wAA t{O&`/4&)fe@"<$-[jZs'DD-T@GHhֿפŚ Aѷ1q$",ϖDpgF`B#Ì2}iU?82Ʀ9*}Yxɦ,6[SF\m2],hFlF# "c:Йf&L;Vf%@B2/Ed́%)fy c`x6:`Y &-F<~Ath>YlfzL4AªJԎ1LڐTVfz4.AEˠR\V%ZUz?R8Ic @-bVK#.ڠUnMC5ݛ@p|#rF pZ2jUe9@s| M#9_ǂOumXCB a5[2zeUZZZ,xۢF9&z#~-TUG޾3nK@|v{Vyp#05""Ew^^;P`JB~C1Q;->&3;P0XV`2,bBbC;`mIeځ6gyDn{"vxœT31̹'iie9S!; 2|U33^p< ccy9>貙P˂!TaZZ+;\p${np\†l#2aܦΫnrdH-M"!mI`5:Ն%v}6rd;U}--2ޢ 'YjFS" E`Kud/s֚O}~آcљ!BEkv,j9GTikfAQ4yp52:01ܽX&j̬^?V8(\y8g6i{JtO2j24>T̫3?9#SG[&ȵc{Kvsi\iml&[C#slVĎנ9/=0 C}X$:|.:`:) 5L4fXjLPY2DI@HИSqyNu[g:# jw+l8%] `bj MhĞ6D1<=pH܅֦3{}+ȧ6X޲fne;Z/],v <2j*/,֟_˺ Qz~5mɅ|l_EYvC9ъ3ӭ"񾞩 "AJ0 $-ݯ2Ŭyzl4F͆^u6iiTY(?eLnYK7 c$nQPn*ah/#y5p:˲) |NrxGowV΃cZ6j-4:c-7:c6N~EH.޺WNiv`oY^sJTIJ@'muрip<4a",hWNK (K(škdRvXx)feDZzBB= ӴK%d(rIYXBJ iEVGCl&jf[aAۗhn$dETM3q>NϰP˪Y[,#WTpVLjz $߹[rP@ܗp1NW-uD$$aԵvtONֵ=JroiWSVxDBY.Q)p+ [X{N@ō0 f=1{^mѭI^ O+b$E I`6`Qbf1=pאan`n5 9FMjlBDwkXa.5#lC94|fyڷ'_wp[̝yj#򡱭TacoW?/>^N rhA0XbOg}ӃIEȹM,k 'b(յ AIhC "P>oYyqfjqa=kUn.;{:Z1%ץz_԰=[bߦps螴6n&kAqzιy7YC)9ybl3#y=]M`#dzZ6U!_J&7͜|e)p`\q^9 ̆P@`y 7wἏ)+ӏV6t8]lI[4͘_u;@mֳ6i_w AQ4`)PUΎ=I{(P( ?Y|D @W>]PBC^ Am Dj"H)!Uqn_BcʼntT +a6y~"txG>j(QLΚ7<("~;cPx^dρt_K} ul}Wz#/-mΈS6w Smg͢ *-C@;!bt(5 G,DW{mf^0zLRPjjwrhpz{+ocy*c#}`y*^mML?BU$Pd<|QuZ,?꾝06@$טbcK=t1B)źc~gc|i (^B{Ϯ Ji>8Oݠ~鈟kP P1dUgb(>W>k w$h+v۪h}Ms1ݻy`pr6w7[l+F#yy< _}Dv]wa^|,UXE@z|n7{1 6F-:cDj @EE%}YY`_}O<Y1Hu W┻\JywU ZOPY*Pv<j$emUA e(ԩ_s6gU@ R* e ?ﷲgQI4A5f*l~΀SYLSP."ҒV:n D:h(4[h#!Az`ADX:-b*s6֔`5| ZI!S6woLYXHbYUTF,b EATQUvaXDI*1Lw* & EmD21QQJj:"{;^fN@-MeF(Ol}JcXiz5A/s1V$j fX{jQK㋥q*M2uI앓Z:f:ܠY5n# CVhފc 'moaRyAMnW>R(mI7O/zsCf!9:?j5L9 I8Ȧ̬Y'FM&.ndŒ;[6!AdpY&E!xI"l I'SCkk!,i& `iYdf1Gd P5hBx1!Sd+f;OD "GBAl 7VX_YaE"8Eо:[Zhf=m* o>} qXьI7Lj8u$n55r&U} <{S-f9O@DZzUS)utWrl=#9֤Ȍ%yC}fi#sltrMq(Y)$(.@р}M2 JSh^xȱ›,Cz)W, ;0d|Ȓް! \ї5x T2BM{u"&>C"W ٻI #l6w` "iJP|zSGy]3`< | B'a7/&CtGh8Q^+ZNo?P݂`Mm_jS^f;Y}ҕI ͅ3AN.r;Ial Z2[FX\/R'ʄa4%.;I$F$CbJ9Nf,s9%[pD`3\U%&2Nr]q$ v־Va {rBWD,&#A@48[S5r3CE4 b.%hEr_q R"@wWUN艊,!`a` oUK1 ίONVB sX?HB:f`_%[g݄LFtNj$m]j5Elb0*Ca MidF-eXX +X9L.X|FM,&  %Wf Ìh ! dp͘%|85Q7jt[n8+_S1,XYF窩0>P BkG(0ϑFWdаy$2W B(Ȧ$-(Р8Fk")IrvˁQ]Z,!X=-& +BXD lsh3 ?C;UcFU3SVmhԈnC Fض2mSJvj1Ɯf{H)HUP*&7ChU-#mGS*̂"id1?g՟ 4±:Qa1GK^KlOoڨƄғB:f0 3ʃ--"DL/-m"Ǯ m=IV`GUkmq"R] Z)R2N6)Y9:5n @$ ̀]7"YvVR(԰EͻطEq-T>A"`{.\']ؒ"JZԇȹT-q0RiIK zS@tQc*[B(֡_\ͯը> h Z+91 +4E\C E#cmU9$ŲLQm*Z]@sQ\4زY_49e ikm †ŸIi@S-/:$ult(dZ$\ǗЃK1tW;\ \*Ĝ܋Au qG5l-v BQ ,˫l/8/rHI{'bo ݕi/GH)'cAHi%#%yVID v Ap,v}T`ʦtjA &ëa"f5$TR[fMUt7,Oqf ꈙ +2NK`4H"- &ZdBp:QҋbBcJx'dA}}mLa{X  Fv0cTX fn[b@jOYH(XU: gGF2b#(;'(8{} lO6_GG(,+h%@e7̄Iۧr?* .-HH`I"O,M1@lаT TK,lzoc_bז &?Kvں5"1#p_[>dyB!e?}\CV cc~f^-i<?@!s8{:Jq"<SU"Lo aC)mfOp{2Kx;ļBnWJȄXzI+R(AAH RH("A@dP ` O^XB* )"a hEPX)E ,`J냎(`~TD]i¦! Igݳ_M% il֦}5z{Ih{նc 7t@wfh? UupUIF[,@)׬ tXaHז}erBv^Skm4HڗG)pɮ]|BEά/_yeg.*]96۪9PݹX0 OOh^3І[AB )DćTX/Oj2t0V ?H5D!_`uڹv7? 092C] u|k>3u@W(;:x+c:4?ođIˏ-XI-/3޾JNL@,Z/.\q|tۆ_1,|  Nl'LEs4\K0uFJrڗaBA @WX9  2夳5݅_j$3aVLb D?(CP%?œsus&M , UVxGH(I/HQHT+P蒰,EQ' *xYUPQE,QVc3 8a(1Q6d( TC)Zŀ[LmOWeFce[(351UEPD 7qZT X2U VbhD: cDת GE, p@[E'gw/w kֱi40o:KT Lt20 #6lM6N>37Ʀ%x';1jr zv5&Țw5^TξY{|kRi"I8.vvvLmáNn؝AîvleLp+'c'' $o92!̀brDSu^7dVC$rKB5gv@Bt0íّ Yğ,זz(Ta$ aqv93*Cn`!IEىNE)m}خ{bv|qk!@xE$0\;=w/yZA^.ᝤ TkIkM߅h6e@v92Y38cY7y﹭^v3t׌ol͔qߴY^d3ܠtheLQ\fǬ&Emkf AmT}mwthfcԊmxiņ+.6I Qz),%å6b)MZ;RŨmHLp333. hNSfVs囼YYΛNO6ccLkl{z4͸M\Wgf51; 8xHvIcͼv mї˥M1tvf6wǎ[4C*^-w)\5 Nqu0+ 00nrCx0"E|.C $";p̀63#zwaK@Ssji]VTq dYtXc%BʃKJoI4YKAɘeh׫!d6]ZjV۳d;AլfXn% 5kw7[c6"{95,W7G^^6̘-Cq3 雺* -j.Y7ՋƩ.]rNeSd d8Z,+Z89η[%N8Fc1ْn$^`lZuleJTݒ!NYNG+ )::Ѻ.WM2miˣthז;!ɚIC"EE+J"B\Ϫj~ME5 AQ:]Zn2aYMykrY3nNʮE(S$ 8rx(hf!@㻎ڡ%y!5):29ՇqAgRv1h*z!hoZ0qQOKsC7[T2qs;[4^N\qRq8agaчh6۞o3QZu}JM۝8N Xu*S@W.$ e &4WÐ̩ØXIo:iLm6Na,ʜ8.'M2iHdPٜ٘6Um+G+9m+mgr~{j#F]`U%tG窽LfMR\t3ZM]^2kM;dE {EMѮ ;˩1uhaٶfrk͕ D ʹjW/U&Ӧrk1'm&'U,.pHOŢ֒F:йdY* FQ-l([W̓P!s!Xϔ0sIʻE ެ嶎~g&)rkȄPQ^JA-žLyN)iL:fΔ.s]n1M.꛺ڛ!έU 1 s1Awz hnŚjNZfv[qv[6vJ-A\řB^ƏD5 YX,:sс]P^؜Ur9{UU6Nb6HbCNWNwsNLVBw+,4%8ISC~T6Rf J tv̑;'g"qKwZrBå(Ι4˂՗T4v׹-Z" RTL&+]k06M M'Zv^)Qt5ŔL{/-\C>Ik AiIń0AQ$u=_30D:9&͌ f7Ð֋v֕M07ݦ:x@ُcZ4cj- (DժQ8"Q$(LE(aXZ!!bp\%"`ޓ)DARH^8;2ۧ&^fݮ3t0"HO;l[^5ՆƬݔ]kY48x}iӣF=YM^v ذES|Q6չRgDۥنrɭ9gDA"*-*(Ha!2դAk%:w/1%^IK-4efYMiJF)\EDP.qdI%ُ*^sNgdVTᝦIjŮH) RȕR9{LڧFӇV黜^h-ch&Pk!XbD69jR ar\\deo{).l1`"^%S*9B(Tg%t"} ~Xo3{t¹z<$E7.CeiefG/c1jtO$FdE }JK!>E , ,`EB,*RDI@PI?%,$) $ sk\E׸5gMv5,s׊Fnw˛o`ւ7@̇D2ޭ9CY>N8X vnVQ#wQJ3}Y}yW[{_Awfq^Gu(ave詫ȶL)- CPޤV^ĸ'i@HGZެ%xy%e%O3x0Wܷa>Ny[{_YN+N { PP RP 004D%c?W3x=n'gJ|e 3z7՝ 05okfձCGąmhI t37H$?]5/nG]Um: +/:lYߙG:+]QG筫pB þ喫<>NymMQ&,W3z_ؕpo;[[imN7o|׳հ_)DM?0rV:^]CR7K)rUįa*F9}7IS,t6e7P4σ/mXSB'2!}5TYj֡@:o> (AǾ3yihVKv,_SE$Rx.vDQ-d/PWF7@|x*T_i@S (''QVh"C+J"%WjMQRƑ L\cLM6P?\\*==[gn{x;kTawFUy4yfINJ#0M6;zJerb: (ƥ8 U DY*f)F+Ӆ3"yPX :7VXBQ ~i#"d]]-`= B%r`dl4wxO^ݻj"o7 DCi"&lE Rt1TFEeTۯ,+ va zq(Dⷛ%݃WHO#?Ш$^_=a($cr4168}BʕFNf(**~Y<@{YxM(Mf2?/'O[ 45/tVvNﶆX ?NdPW?a܈}PkgQ<о pt=2X :Ղ`$ԃQ@ΈR^6Ԟk3_أU>wׂ n 5cŀoVDN/2 $c:>JPT/aΉWX79PS,HDm?}cdĤʧUBwtQ쉯d٢+]6tD$w|<"t<~ǭԟxNM;X[6YV`mF^oV9d0qe;)&&tYyPq5EG[}.?y _#GQQp-:*9ޚHPiKaFw0#ۼރ9"&"%AͿ{{7<+\ {+042-fX0K.8ܤ{ >ʖln.1?2u!]}cuK;+D.d2 ËU"؂1G̮[ [؄e (XOɍb#QX"roѸ2%NQ H-ExJ<{ YNb$0:&-Wpn<4>婶M^$cV>.pq{;gYIa7EBbqwYe-"s!R^]I BdP`pdSd1C)Ϫfk?'1jw t_1mFŁ>]@i^QY)?măJjnar<^2|%ahI22.L,fo>4% x`c5E%JՇp+Sֲ@.rP j.X柠Vk=Z,wZ2!pWU4u?(ze(8#g|שf B-~Eez=s>cݮl& vs7tf!}v2>4%̷IpKYWe)'srz(,+jxI6i_a[Ѭ6qw~{н6jA+[}id]xmL7g$V\lh2TKwj<+iK)sq4J%Dd:Y H~+6T ?`FEBC  (m<'Xq",ln[2IJŽiW_͠QlW&MEQm WՌ$ Jh.>:53vpW3svulZT/VOa۫&F46wf1 fz1A3]OTBCjT>(l<ж_TO[L$ްLA'y_mu<@2s"04>*I!fo՜ hfU*IʚquW^Uf'ԧR=Ճ9 zmov=g#EH`cQY5f׍=>ypT)ŀQ8ٴ܉3&)V:~;9{AM5X{YbBlN"\=pYqpR@v5ˁؽz9UB_/5*J:;0|\\WC]NMuU@T55aDzrhhA,A%b-Gt ~[uKy-x1{]e Bi_%ZH^|%7ͱr=^-=|vg9J9{S:9vVա珝10`!9W$gL4ّ47ϱߑ6 إm#Gr:Surbl/bJ[riR;e?Nޮ/C56텍*Ã.jrC(1^xXod λ+D|Y'ؙhsagyP}N%-69J"X\ᰈWW^]D6g{Ruiݢ?m  ( v|0?B@ NwroNbpi~zBŊf|c'(\UBmJg,V/avKR֣dY(ז R0'  !ߗ-3+&m+S|u,gF_+@_n_ۙV|k=ӂ7pS [S,3 ?lZARk}QivS & w<ۮwUmBD[%k޲hOȟ_u=foKZX/Hzw۔=WuY_;k_PZ4e9S8*Ɠ%n[2橈NO1pv\_K[7ᤣq?=aG8A jy_OGL~cȒ mGzOW|\3]҂#{A^7 jv1Nއ̱@pQOoY;C3WcvӣqHcW2 5`_} `舤 /қsܳ3i]L|Յ= T8x/"o&sxF5N]j)JS8{qfKT%c~SHDUg$$>džV4 -ک%~Ùg:^!m_A#ow)xσ#TT%k zTUnTP$7L"2¶#>Ew(;sЅHӋ:sa'2{Z#*9&z>mx($7.k`EY[BB+t2cYb\ԷH__l萝8 P/n OG3 k6{`ЎPᮿo~T\DӍ'lt6_&ϟ8N-[ɕ,Gw8 a7䖅~=<`<#گv]Pi0Xbal:Z2 t##~B){?7q^\ޅ6>r}A/I*O?uE/C24v;5"'ݫzE\:{ky.42a˳6 wik|)/3Peݷ }jVŵSr#bpM췑#n,>&= oy7Np151A@f?LfmF2_Wm77aQc)hT$ "шȰ=Р_/7S}baEo>-<>ڿ lm|\(;-b{Y^FBX, `VɼEW{t>3bU}ǷVAyHcuX_'7᳴Z{\M~){ы VHD""!U@efqy &.os'j'ܡ $⋰س0 +}\]Kߘuk`Eh˫7.a ۊ$J ϖ ;?IG.h:@sCb0vǠo4RBX&viȴ0Eѝ+qWuqaW;|P%jG//~6Ү-SgJ16cPX'zk[7jD8)䣄!^}G/R },Q ;>~HRw[OS_][PcXx:uekghP =[5w>4&)D V0Of.E&Q@"3|3?s/ ɇɀȾ?Q_vE u "kT2y鞉4c3]vxH@2 J4KM#7E°w5?Nlm<Ʊ̹5O}z oi]߉g|{8Ŵ&Y&/{^y18;nh?Ȅ!$;W__b_juŲL~NèLO e *yxO'vPo(}*[ߣ6S`JSiJT #vY5($7SWcLv( *_,4޲Oe@GΡmr>!q:PfG!8|zU4 +# *(Pp @@=Uq@=lG6_"_ (gPج/J~>[VLxwy;grOΊW]b e#ex.{.$ޥP0ϹvvrYZe,o[ ٛyIDۮz9>Mj2;RD,Qg2#^:ݬU'?C0t]$9T+,(7w)c@6>]/U~ &VZ79dw}lr~DW}s2Jፕl>MD5 eGW^ʬ_zgW.ӱtXVsgq/ǺlÇ ZgۨןlO#/~C#PP X 8.C 3T+H}]e3o),Cu>5w$DJ5RaÂYgy:̓)b>74 6nwNTB$= y^͑@PRDdF IѼZԅdE9*ZA}DTdREXEr` V?SZ3ҿ}fT?}ť d-+|O?8n$gr? v1_WUۥv';BY_2^Q!=0H( G's( i%#,Όsh6$VbzIe#VPeuDwutߵVŁёT~ӳv|jgiGQr8Wi%bIQc Vd=?fI } lW)(:ˆ6RN$(r;I #֟9kmO{}I';5ZoZ"HsR> ׋? [ؠ^ޔ0=z4m ?GxL?XUTAO9AegRAgPq GPl-@7G.Wļ\@ǰ:FkBq@|4P-ƬXGPliW`;~. ߖK5MLCÿi+*Diq maɱ6#@-D#X&8}αԀq3jSuVN; _i7;C&Ȥ2+"H!", )5;-m:9r^6aPDX `b( DH,)DPUbyXA!Ե ~ iH G#0D!v|ne$H!@Xo@g/u:"ua_<3 altD YI:&(`ET*Ak cu1$X*2I+ A`XT*0bTҭd?@!sņ4qus< ov]vv U'qhuu~N&]3n[x{t6sw8p.n{5UN\Bx/zz< eQk,Hr$H'P캏/ vpX9E?ƈ o'uD*}?* SwS|M^o^M e!"$EZ†25z0I  "4[=&[胆(T=JQJֶ^9J {c]z깻~9Yɺ* p?B#㗆}ug5_ۯ Il3sYf0wL%8~'cda$d'|?7;r\ʑg D23"2*6Ũ+*0kD(I>?yWcϕajK5 \azt}JkﲇϛWK띧p xu"{}y~꽱؃"^ wعV4"6ءc|\  }-{`T@^3Sk0Wb6fia|ݿFFiE"@ȁb#Q}]y< ϊHFע,g3^'3fB#b!.Ry A3/;qS l:zsݱ1?sW.-"ލLv_7g(0z=4?[>π1Kl|Kg;x|ϛuRN=KIC ChD@^w6 H~7'N$T埧8_SaibBC("QDI*DTQHR̾z+ )PD-h.[Э#ɘD= D'/3Sp +| F@Y;V,F1b@R,jDbdAH H cGX>oy]9v Qg瞶k3 ꍷK9]F^>c|錠~xoK@_&9Vo|5^W=/łhP;ԟrxⰾȂOӃ'OZ`~kyrOv&|> ;z[A/WE |CY$?|Ҡ} Q9kt}͋qp"7_"GA6h(@ jJ+AA 3YZOkYum*Z\CCXSXwfR]muWg$T uL@b$BTC멮 !ƇX3!)tnbF{HIL.׃ #Vuk\wD>g}|P(Hv3`{@u,nU(c/w'w[\(f`x)6XJ!:U\@V{ e@fZh};Z>@+?ȢI/)}T=eP{]AFS+Lks!H! !~eE_Um)t48aalPX)E I$Y,A?+/ܠ k&l5|ծ8?CA5^+fϯ@dT[֡6 rnkxq(+HRB=*pmWN ̫CAO:}]^[Nif(\C6_ju7[3r,rj#d1w>6 8 dЍuYkeZ+sE_sך!BVU#;؈a BByba㩺rZk<7VDOédƄRE1"{!Q;ӛ&ɦ.#)Wt<-J !"P5% I澢^صETd["KL#[de bnbl8\ g/fc4a4H}͂dg/zROF2uMH"r}i&+M>J& 1 UQE ]4Km+.و83S3qu(|s#*IAn@?',S}vdߜIF.)6L1lytן"Du=X.TڹB.!yb[XB yY6q'"_|9%ZD;' !q;|/"2A_~_hW,p%e#|nn=fc#LCoB ׏%-Ǖ~ry23i!< $7>VyVC,(r%H]~.@,3F_+'p9Ne l>j,^n6U r:Ltuw.Fzn3AQ\RmIH$' 腮JV/0ljZbx-<}4tKDUAPU.,>/scn}:ڂ#% ڜjYʋ~,ԌgRƂl@TEA"(+AHcrirZBitQڴaN{}}}hY:P =;WT4)13VT}WU+<Ǵf38]] ˏGX׀}5*S=ĸ L7#u#3 Z%~0 eYձ~f%]%k>F$cMlv]DF]D]G {Z\X޳ hb6&-Xd AFI)nM2+KtiC04ˉ'*XGNVq뤇d̏%(iJMTdDN'Lɜ,e'i0G$hƀz5 _q,֢}>řUY;%+ͣ^ SSLpp4v0WU]Vp! uF] ENU1kv61/+)&O\ O8q~桿uR}>p^Bf§^hq а@K*]Ȃqh b:IDi=,BstIٮJwcD9Sc+~)-y=Z'?[%b,^ްOѝQo_9Q=Sw I.QytG!3ofбR6#|rڦ88!?o^q l{# .^R&d^9bm!_Vm/zMֈ}\kZY3[Uw TMx]Xyȏ!p% |%$NP׍h -jhu>AQlu0PjAJ!t8yӚnf d̹ */g.QvnMN u,d&)~(9.V.^tw"8aŁ~ْղ~{ t[ݭvx;r ef7K#쿬p'3K3["^N|/&< B׺/ɮVZye>@xRu#:3$@ykA#Yl4wG&Bp nSk*Qs8ibڗA  4B6P߂ ;prbBaY/kH>[EMY.%vd%"e?I v@:Ԓ4:zW١],W&9[͉ 6osX0z As 8*Қ[xLbڦѻRQkRu/VU1\ꊄC ("C{sxH1hIZ/˴)-WOY $a D ƋT;{'n/1dz9޸FZJ̚j&q8IĄЕ]XH Uh*QI3-Cw.v$;](xd>Cϣ(ƂBP+D$mc_zuv߼im=-ޤ1rk9BdDEGC]B;4[X=5XQ 0o_OtpMHeK /*A1CJ2 ,2Q87_῱7F7ggwFGI %8\۵{6'8ζ@ݜ>׍zѬ@7W떠n$yNEXJg%%\C" ,"m2zж4lq) RM`wYW!l"eAJohqp:.ʌˮD>S<`&GgЦ X_ xN53:gĜKS2 B*FJ+KiǑxf[Rt͢h)9F?@ uƖq*<8۞n oBǕU}BB14tZQ/qYvk )iH_V}`^-Jvv/A7qiAY(zD'ءr3CGN0X%fSa0ػ1 Lɕ{>ׯ^!l5L-C_0v} V$-a+Yf69b6e g Z`;t ֲʦ Dd`9Y/l =58wPi9 @;-~̖L0%sU]"l2K~|ݦafZM[offƗ tȺ)6eOAоlY>Sέ멖n9e1sr2?ia& sh6#ٿ,%yK!!3I=s{dW>VMOwp,xt.J7e tl}O:.ig<{/fDJYJS?ڣ(dZ/0qޑ5C=ɻןݷ3I6S?adv&`8]-Œgit0e'&c(XH > g C4|;VV??"޽HfAwXw;^vSP R RJP?xE *YܘT^ay0Ԡxa ^7Җ=>;FE6^G=vUDdN3HUkܩinh[ KFVd'L+UR< c; 4'jVNJY ^=whjpZD%~[f?>zZǖr/>'ʽw-"~tEsFÿ.2WnǓW3+Fꌞ^JzG( U Amgټ;PU:@E:7mzoD|,=c?CL(`V }RIL2˛KMїҫH437zYjm:}ϫ3+e))>(&8+0?G9{۫na0Z5wYD ϰH0}x'ccq"i!6f*(.8 rM>)CpU_\׻&܄Q)aX BRjo$p|#lI,FG ^}7?sT}_W ZA t D2?tijh5snpq,1򍝿XcUo23vBlTl%&rLyl$4<.22R7ӳfa496egLBzxŘJrO#12 s^Y@#dD8O&գـG!Ktz>cmb q s~7ʲ@@ -JR_:T%/QfkXW}0xK~$@ VG2f3ajLB,<'󍢻_ֹ;Nšwn=k߾]w{{n-cήhq[+Ymz~^vMKb{%[ GS9*[Ӫ n/27vn':;qϭsbd>m=oEP!wHn@@G׫V z&H  " ш@Տ+Htz;{yHKջ^)6-JSom_  /Aa*VCdn! سl([s]DZ|ۿ H2Yd/烴z;N}Gk\yeQ,1`!)p@eA=j8^,or La*|íemg'inK{ E xxqͿYs{ωvŜ:.måf e iL41X/1Q&$| Sځ WwtOh_mI:Ч; IPQ펊s-Ø;~(9ICQd\ax! .b>fP4q::̽4(ETkx^WBCSYUsy|\z[ i߳ii^a|5ε|g0v[l$d̂0Xt+bՖ®?Naa(sIeb~%~͵$mbZT_n}dth6H|/-ȵ"Q*ow" , OΎ} ~-ETɟWB{*a7iC̍ۊ0+sOqb* Ƚ[>Gm{\a,NfY?iTǓ 9tqx?;wV,Oc}S|<]Wv:,ή֦7*#S7]=seI_4pgzv2<᲎ ȓFB-b[rG NZnKS˟(RW?9b"ٝnIʀd4 !sQYMv)trs !Z -^Lw_ ZyH L54.,6z /~2G<ކCrקM\=C}? JHvIM0ŧ Y-/Uf}Ǘ:0KRb b>=&9NW3_zg_. IQh$s L"^a9Â6 r7^S#$~ fĊ^@ t<$\>I(E7>7̼<>b)OsH@)154[x>(l^gg{ A`Ά| .BJNAI7s+Rk]!3LIervMG؈7Y=zCs4g qcA|0fd09)Y5_em[fr\9uE1sb6DZʡV5;.:":7RB<50W>~H Sd F,$<} #w0Ԍ0@!>>EΟgY|9F_ZE9_:/[R<T$P={=Mk-[N/yu2{[fF={97J&(eEhb͹ }k¥>~/WhJj#^I^Tv.V-NK^lSa@MNxlDu1A*1dD#(t^?d<R-:YOSzEFLے\1dz]lj·N鹾ͭޥ - J?Uۮ|(@"M >i;TSec(`/;yUGWUQ#@.8D\^Y̮ -d.Jb]{N=}րpUp5 yԅ$b1 uB ^sQ_TvL pi,{_?kG4b]tDҟQ`G=(}ex}R&| rFڿUf-@ؐ&- 7Jg4i/mz$pۇ>_~Y$#xfm89bXxdH -, 9t9(nҀĸۜN.fKJߎWmڻ[[H4;W<vgH͵TR8ovFZ(p}7N e;}w2٦Wmn7xEq޼reXhW>va2z;W3B*^sGOgҥFđIà'sD@HT^'ryլҝp0,,ҎOs1"#ޔiYrGިMHΘ%*?ly1Hz\' ]Or(?d肟u2 BU@"sϻV1hu1dϸD_{QJ82{|bj7=Ѭ*m9CYtsD@%0މ1AD I HnGw)gnj"@j0& P` 8pC/S( E|uu^N xE8ݬ%TyZNuXrr}S0 `Iz|7[XݯUAΉf;bKHkKR:gVWPzauڭ"%AW}<nle!uip~C}zQ@X,U@PX"ȣ` QTX*#(0*O>ug.@EEbDX(`_Gݟ?^G3ff?gQd\0{<|뼛{_^-Km5T̅7uYR $En(ګ.m- Z}aXSo^.wG\Xx'-b9 4܄gM1ƥm%t⮝GźUIp̃:& 0:nͧ@q90KW!+M/g n2+ _JW]oƀ.s˼aҎG/Kg{qN>|mN*3Wr_>3f~2`6+,~Nb)4"!'RS4VNٴo[vEQbeQ'qƈH+MEI\|dkb\C-  %f.fJvC7ly+R1]1*rN\TT;d3!or 2j8% `Q\]nxwP#nn.s!%L#@mbߒ@QuEm>b%Eݤzd5M4 ]%Y"u^+]ВC7ʾ|Jw{ 72@$D$RA 4~%{,PbC}nF*A,UxSe+YxJݝ>Kip$ra4DV ,ʬe\='_ R,29zXV&>+5k2D7}(^F{[d6AD0%isl*`S1W_e/n`鶳.fA QF1A"$T"+V@,Uaތ~f YcOb J(!;Ӎd ;D!BIs|]Fo?d6p;tUסB^l /.59M$e=X`8',mE2 kVYYw 'j(=ƅl5݃29*.8u]_i>ˀgʜ珿k}GaȒi}e9| x.(aI64 >u7 ל'ei _[3i37UgN>wfHJE$%ABo$p4|r[ZvD閲{>\ n6oK (:ȗ1Ab0?NCts7L3q?E{T@3`^KE6M.޳hףy8_Nׯv Ep{T YѨEh= d{}a UdhvuRj+y1ӌ/zϷG8'g Sb91 yӖ6&YZ~KiSR-)9g'8gQs1y~ Ե=m>oΓ3l\fzqݛmG'ESRov:eU(ncח{_oX]y.R(=> #vi30wM熋28y@aDuXr!31P1]In=] LiLd#kܠ2/x6_=0 B'gӚz-͇D=Q _bDpg Z] 8) c\#=C'G6̕LVP$rhk#(އ#ٲ?f2n3cA7`H3@B/Gјpp(^^{-װz _CT '5Nd$fL<юV,v0ٸ:''Kt1GZT(e{TDnu5 , cs8tʒkLwe\@+€F0c"CUXbMF%$FAH1ȃiGvpf6.K](ܥfY;Xr2 B:옽m@&v kySMթ_"$R3 ^kf Φ:JKj?}an+)4w˞>5 ARݗaplP%ET 5QycW>Vص?F0K~.U8%zvͲwW*;NNYA^ǻұlf;겙:7EM>>ܵqY\ 92~~QYBfkE@.mWwab~|j NJ|#`*["! iڕPd~Û] ;uJ< 4_vz@,5O#YxZ=)Tj7iMT542l*rq BFfPjEz_@+MuEFu.῏+Y6(pE_7#ԉf}%Ys7Q52߇Y"G{ &61 PcuUHSު%;o 9Ud ae@=U ))^ŷ??ygif5k1%7LƄgHjn5ʥZ#t\*|sGZkվvf%wݒXY>8w3 11Y(.dKO%. Y; =^-3 /9oH(a_zw7I$>|<XB{5/3j/ok~`5H6a8?9$3vXd%#׀N xwn=]^<Bi@vKM\>! VĔ*Gikmm]D#tpy~ZU"adE"<y]Ad rˁU]Ť9j4@ p瀜JLl~77/ m6aw0Oާ07瞤;ae[sO56N^Oika(#zz#3ֹC;{d[J $ E#f}qk`_, 2韋o;G'(YѿzDJ tl136aAK꨹z`вs[7^~}.V0vQit> ~Oѵ].+,}'=(܉_g4L^MRs8m҄` 4~7œT ?zpgQ ֦}o}aAӖ29T[0@߭Lo)MU@њhP*Ԋ!l@78H"!NE,>X*>R߅Cأ-|_Y <)tW"Z2q__BO h ?o_ޕkk`pmY&PMdő5`brO<⟅4݂t!YA~.gqQd.ÛKM" EٝNn, y٤u)k\Zi,p䯤&-d_e>V38QAyukˈB=O%wjY~()ؒ+<gfEHm @SRz/UEzYmtuuz׊Q=AkX]V{" ":2I. Ag *H}CvlPKа0]o Gsñd"BW?A+Y_rnra?,m;rˀ9l~~iۻ~<}/! 6\$ӥA=az߉ >'M~>8SA)䚷F@I$h&\ٺ\+#?&}ePgkm2fRzVJ sg\qPIp=P?Md/#EKycWYՒ4:٤M䝭UvY9<>sTk>ơ͜,cӣ7;` ` #E#j- i ]p;-\L|MP#Z HQw%XVu>)guEtrW粍NjU퀃,Q{7y=.i2>tn6TN a'8wgugx o7`_]«.:Y܅8L'ͨNK ~r2Lg7~ʊNMRy/] e$^Rd *1̠ܕ1aP2d>ß3 [y֜5cW3/>cӪ`(Sb0:[cQf7gud\yq\|zs^H9 ڽ0oz6ظvݒmmle̸̟:`P2.չ[&׸^cjirYW[όXz-omv$Uu1E"$$9n62=: ]o|T%a "S"l{c, .9D=H 1 J#VFb cU8=~;߃A30rXȀu[W.Sk`5>Ӆrk۸SI>\`]f _8k|8[~=7=-=.> "Fo(}tCey~?_ <ΆARٮ>7Z]-Ǻ5+3dey*5z<k ss@ qt\\Ua ɩi6/]?hcA_aII{uYy!`J%.h ̽X@YԎyQ]NI#^_Cӆ;55·?eGiuī,Seb獞?Z݈9t.lpk Zۈ6v享&G+J;T_$L2oА'`B O =M]>ucS]\ak;.~ZǺs^{`#DzK+O TEG Є$?{`Pץnۚ.s]ǢJ[ocf/>X3!)JQEf(C~mzjq/io]P!F [aZ-AMi!!NC>C+졐P2Kut؋fW+z'bCb!֭kiy> k"BihV zD. \^KjW@B[0d#I.K:{Y&P(0`xE^Y$%C_a;f>.jj]@N`\‡~Oxie.UzY}cHv1ܷ\,_+ք)J%$%(e%0DF2@|bKHIz}|'H cl*Qc^gr F ښolKX`Cr9a{~?G}N}cF+!̽(>5oS޼եD0`_~y)zh܉41[{:WXg)~ǥ]ڀݿÛ}J]w[ :"˒c9[0 b:_ߩuoa?$ArmɎaђS:r鐮YNo ]\}jWST?N$6y.i&] I +X$io ItԖ$IwL6$J vk02L)4ez;%*0(m(Dvޛg}J-.֐ @QV쳣dxLt57o=֦P<N(n/ Z)dřYDΌѲ piP{+{֫fw錟wO@z ѐ0$]m-"Lҕ jC8aIjs 0FA >a@cJ1Le!x6袨z"3~HgXI؜PCn ?~g{JWv߽w`*ڜ-=|JNz=U$HۃeN~R`p=tTJw& ё y;<齅K3L+%ædfqa/I#p)9wS B_N(DzLj"ǤtF}c:"1˶H40}7gz޲ñ- K$"ke7%Tn>+eLL!V-O63, ߥ F PC3" *_^bR:]gN+:0j0g&ljҽ@S3Θ.U?H.t"Il YP͜\ 3!}37o36]4QԄۚI @@v 3M"=[J,{m3Lhjoŝ_$IYC4&\'n(lV9zu(xrDh8o|pzX {&qғD@aT0,h@ 4űOeuMޑ_^[Oh: )ݐ'u!v 'tn), YI5q@Iw$cA, uE=A EAeiZY>>IRծA" Kۻ0(gIu+heG WPw*r7"~5~C<许e@ 0@ L顄@%H1NG[wS_"J͢~)힜:3zu*\u 6`x|D %.huBz8XS Q /yoeIlGyfsΟ1A{' e"ӷ +.WBwx?sE؅cJK!uVv+r{[8Xax_Q~ii4p]]T]%b1R^;.32c<MOxBz|J0,4,k!C5q$0۫3;CV3IhPNrC4VݹM(ȳ>z'2x*?Csp4Œ@FH"djZAHi8\aY8']㢚T澧7Tjw{H72) N_U]0Xg=fjh*86*3\z939? {BUf H6A8} $8S-J3͏$o!8o ڭJ`:1 kÖ64%UmV :°B$ٕ1گoJ$| v'ˍ-N`1&uRj.&xH{{OB"`ߋ'y5>T &J`Ys?Kp*Qa62`&pC"9P1..Mƶ/C?9PޛcF|}jꡀD fEcG6Fluԝ&+k(́IܬQ8&Iv.{3$_kT:|fl[3Do%,b!{W(zh]SETvSP{_sPw! yZ޴g uљ  8q5,OmSxrGרvZ)Ӿ'2,+'R!Kؾ{=$@vQXq<쉼ЃA=}$dDuoV"x[j6>D6/ېegftMb?"Jrs>e&Qǹjm{LȺt7gҐ.(RD@_}PK!f S UY4s*Յjt?SRѷɈ2DM'T}U|fe(^2 A|xjN,4Ҩtā3+,/ &2dNu p_"+y ; G^0 Q:<-!Skkr{p -jP5 {tPN$dpi&lEi1dU"]#ֺjg/eZkuL[<6" Kpz ;$glw0g-wq+d濊D~5Sf`8,fS}^<=q4q~KȚo.WuW rұL+w<_yizEMUd@Ś-BbφN'AB|gh$`X]u=h@y'e֔{6=ŁUlhq>̮q EK7."@]PT\2 Osv)H钩/jE=9":сGR/BzMw?sɲ`~eݒBu|v| < :0+>cnsvy`KU8zy`n kAx4ފ@~S9=4AaBǭ_sW>oͮ m?wWM<7i(9J:cHbxv; 4,pD'#ՇTw֭[0C\YeX@mV?DZr$Nˋݛ!5>,/sO5=\6]M?xC,4>W~~m[ɒwn"4=Ob,ZL6h@RwE[z 8D 1Ag.G a.Ay^_VDO teʦ /(Oz|jAY GՎaInx1xK2ɝfGkXB*Ht7sZ=}#󜶎VIFgm_ʤ O"ߚ  9r[ GP6NwAgkM*Իp"! n/TX}woN1D/8-}xp^D HHs@uj%N򠮶aipz$_`hP B%)u+fǫc+5칱]ȡz3t:3+DBugeuwe&ϧKL8Xuj1 nց*[Ztq^NZR;|  06<᭩]W.O>jqLp oZؒĢc#ŤH 恦:ƴ}J 0 :@#Ouރ:.ngij>:/?:F1Gf[[O5QyI w-)@p`!`wWG8&Cqn WOC*EkJT.\ %ĐeHc1D 0'dQ*Md*- dDݚqM4;И݀lj)Kp0+Ks;*a)hmKuj{PXزcy}-/?Zrif]mEe9j!D"7oю8{Z3TK[_S~s{֋\cI!/8CAL:8ff7Ia]Z<*hB dAoBp&I+c@0] +Ta$EI!+]q!i(= B84y̛ÅC"ϛYT9 MJ:Jb}"bFܦ m{w$j N텩v,9=oS2$F8bpWׁ( u\ou,YHg/l0˽u$ gWfC 'j:i?fՌ`D-7`0E'Z 8cc,. ~M<  v%lkJ&RyԣCIetOF ?UL|;3ӍD!@1=wsdXl+✎-2=?y ~YaGY H߬| ѩɘ -$c>[5J.y½ܫ=Y00>~%I?RG;Asgݲ 9,rNj[&U۟e[ w*Ϟw,Ops? cm̎AsJlXCZX:}ׇl~?/_}f *hߡf߈t(І͐*+nGzOexiQ+nI$ 8(8D5BEXAax.D ޵˽v! dj"BPsK ﾲS!#s7Bs? gcg)u6|v/Dٻ6yzƀd$@'q4g'Hkh,х~?G[@ 7w^PsZۭ}.xgFQ!nSvֹJI|aA?ڇ't;ҶY2k+٣XBIP82&+j0@uI:s{fNg~( 0zP5y{A`|ju~r}#'koNCzCz*u[ΗsNn }:^V) zMEP.@`޺[|*Cٽ_jس@;3rXEVUE E+";UBxU͌uFM_3mc]QJJ*{WGd~V.ጅv;axpڑ\Wa.ej_ͪĉɣ-tgAwmbiB)q %d[8)6@RO|[ *.N@?/x; E)!2)^od]ڳVt9H$b+JMh2qZ\D e(m1'Y!{L#}j $ڿE/, 8$p.]ЇY v˾rYzu"jCϛG Jyx+\޼}yO Kn#@lVTc /G?~B#,,dLGc&J jx <A':/9 9@mO 1B&@pX{f_⵱dQV irrQXqN_*ߵq?f)?h;~ aD?Fg:3xWUײ/ Mw\k+v;V?v;W?UM࿎b*1sʞGz3o(Nfuz\ >=e[M蹚cJM2`"UuM1rDc}n%N;19ڦ + h۳sg 0B>cfqy'fە立g㮨dPO 3!5GuQ;a}~YBĞ7mkA(wBw.Xk^)2i &|ɓ*9I7m 8lF{k YXM-8G^M+񯾍W3dz=:fGEw,L 1$CdbbnP= kHu*<%䠽U꽶u5g5`%.ĭ#;Cbg)F)9H 6ӯI։R%Qik]kHk?΁\gJnROa-oBIjIs$IyLP]J=5a-Ұ drmQ@l㬸dg^pٳh\F$D !:~]DPc=ts@δc7bnk4@Z{+jv~-K['BpX. gͬ $]/Q>Q_(0d^>Z9"FOA~DJ[i!٧` 3OsiM5yv,Ftgp/{ԋH v=(5HbԈa}gҘ4H!\a[cBI(tn;t9pWl=ծŬ$OCt19,cֱyybB FoC/U%J䐽pf,L1kGW.k j ڝHmFz]R$Z[5vVj\7f,ܗ9py$uG }R^ZK&jgTC'>Ȕ'e{ɗj9ۜǕzU$#㽺TWC[gge (g5UVs~k s{w0,+/gvP Gj 0NVٿBC1",JCdPMV;q%Pm呷]%{/(sć J9 1>y B6%ć${cیMvU1am7/"4 -rv.9G3!xX2DJؑaD^a1C~zC}{vooQIf5LqOb^&D ^Ehr{^%f EO9y z5@c(61Z4B4r,bhߧӣuct_MW!۪EUe"7G>SG .>8\:múqN!Xޙfqk~FHԥa8žOԼ$("]׋/aՊZqYEїfe-@M_2q3ݜt[LOn \x䦮RK A}uL{61Pb\J8R~Q gEϡ3ΣerUZ$'!_.iy7TgחXg ۭ"JO@!" #GQ.Vgu-iγ;iC359u@e ׽M:C{:j3KiWZr'}񥾾 tMfv 󶋀fH 8O^ѩhp=-`#*9ذatp:Exn)ɂ0 k\5@h!>Jj]W]c)V|HAEq $?%X^%ȨԽb ٭8aЧDžWVLU8Y Ga͜?pyܫ !H /Y%^I&4ZXm$7[R!fb0S35`hN iO5,s4p{`Mt%:sk S+OPM᫸;,6bJ ³"qV 8qGF}J]uj&B*$툄%~nܾD1|\>/d0-[)ts: 3~[JNJfۼA@zkG$Ig&KXfADa"#n QzOJu!}50*Q!'eƌ2: ϦqQ}3% xs^߫sJ"bnc @"6-PO}Տ4( ~<-,qIJy*QD{]7zf\E,„9tBF z9@k}IϽΘ/ԡ"mIγtWm"P˙M7-t bBnM;';7wE:Z>H66GHsRVC)t\:I?LJ擄8E|(G?חh J6X AjB%݇SǺ},])4x/{Z6-R^"}/BJ0""<9e LGTgIPk=0c?lSҠAУ`u/$],q)lw<[[ qsM?B_ft :8Qs骁RC!P.(KVYb1~ H頋7{SuW1.2}?춙@: WBTԐa@I:]}~ϳ~< oO$r Ka  3 ,Uǎ]&͉=joܮ|WeB) ,8n4;Jqg?|e `lWXBxٟʆI$&raRbz">f[vm&ѻwYes}݂u+^լhR$)sz>bZB):/Xa2lg"ȰWj `~e_?FƩnbnɰSloɡ^/<6cW@|H^Մp ~uˆ^t=|}gp֛j?OBE\`|@DBb"#YGR{Ze CF5% 78 QE5N| zyYvOUҏUI*ҭŎ/B0LL\?Kz>b̢3 /S̀C)daط.m#rM |˞ IiQC`}Ϡ|yO x3:n>@оD)>qf7՛ԓ(dR(E~LZ`՟^RWQ!lm\3Ԅ[}i,&?d6t g,][0j feH?TǦ.5JA3c.?mzzX6Lp]Z*W4J`,U35z]},/qNZg3 jU!h:@t|7/ڨ0/:T6$zӜH*P f39ab@$(K"1?d&й5K>T@$uw 롔kl{ڿo޳nGd54t[=˴5G ޚ8 jh<#8:ط.y5iXuUX95j}F!ɇE[ϚsW=YI%p~(3RT(b^5f.lJL/*sH;XQ ?&9_t*,J{ $5,+gP1A|)cW.(^;5yG4gW{Tc:.6Z;i ?OTpL_hw3"YƲp;PhTC5D@ȋ cq 8 fvn;=eR-ދbj8F#a/kZ]9Q'PV/a}haWEw{|K ]VuzBC)5alC Pࢭ lᣃ{f^E& ]G~O}A}m y}Ik {°]2dOX ]3U~P [DA9agŽÒsIū}浝Z >+D>&oYwvxBv^^qTǶ4IsQ'Č _\HPb\>8Ǔ\CI1 w?_7٘1K[8Ƿ&G~>%~֒`;L&Eo]cR57Dz1ŲAX] 1@oߙ*YK|ak0B[}FA\8Վ2b=h]kd̈ĞAB[i\},] +yiXc"G8"-ՙ ye9W\m un3~تHb(`X*HX30Ҥ譶y`mNmemN(Ktxi;MH{:n>xu+7+א҂%DL0R>N^NkB䓙}]PJX+{rtɓhdCTutTS? u=lR}+g%\uru.ndxsʸB60gS[34/e|i?]=VqBQ( )'Pz!]4\3Q!#l.kf3Mq2_z tH&5ki4 N BʿS#_X&ÎX۔ v:ܧTu]oCǕc0'75o}q-)/@u"fzFUjj3dO̅Ml; &kOjt)TXvrˁb1a/D+emOT]+(&ɔsgvs82Ya/u_9V(RjY0CA[&9Ui@Hh`qr1y:޺~"wzmr]˧70l-89IaX)pA=!b x)TC)7Y1f6䃫3׿^g➍i9"y<= ZͻieFЈbC)]P AfŪ pt`O&n%NC`lj?'(zrT`GY7J,B(6)%Zqw-6̛BB|dgՏ]/nedi-u;|KR Ѻ.;5a|gDj;?qK :VeHɃ@2+`؋_R 4b$q(ʍWjΈok_+rz:_lZFB GH$},X@צ0t JVR[ia B~'BӧD`uZeJCuq/k'&+!5.T'S8>v߄u ȭߵ!¨(bk@f~&X\U@-e80 j@E9qMz5-ZZ, 7UMɺM_@ $\E2 B 8Ƶ}ٸ{6D 7>xi'A^:r^o9zԄ{a{MZhQZ3(VmqmYq܁N#:Hai,,%WuVVx ںvUY(ri4=xRWeߨ\q{ y6=P G|Q,ͺGx ^-'F4WVB G62~Sq~IP-!$# ZfsL$5VQ}/iVҪEDt~НhZKAbsfnp.7s9ۙ;νg+?6KKD$0"n>T@5Džд+S 2Ж!Va[$fuc4Q30~>K@XR%}*۟1, xn]L:^Ad5rf!.l'KyK f5^ϡ!E ՛1iS9B P'i\`RGI ~1C#] sPkVwl0-/RJOTl0Ewzxz{}uR~!#D.gA` #PoU?ם}<]sxqY@p} Lℊ:/L?~GAdN+g[N"qa_XN*ҁRaI)_:Ro oX {GG[2K,t5 r*_qBG ӽCH|q?2h 9 \ywx=Ncc L$̀&z!D(atJaAdEq)'KBC[?CR4V J )n}@|Sm/?DC壥a2A]]Z% +&tpR_]v 8@ Mc18eļ dWᆯo:m&sbPb6B,="`/|!NZzU.s{xNDnc0: F^͟])a$LJ:׹nv]=&R5+Yd}z _#][v\@¦#c5!̶N喐\65lYA: "L!'~mSȁBfA!D i{+Lw,mf ;"̶?cvu ^~ǡ3-!vRu#Hd.#!rhƏ>O6PrCe<:*->>-p`gD~UBѹ&ckJ?: ~O#u_֚ @$yNzBRl^_Ztɀ.]O2``]PIx⻠#8K bPҍ-7Es7y,hvL%XlEDV.P 0ВH(sx0>iR [崖U_kAjlS}پ]g{~H~G>80?29/X{HXCS_Sܰ.B~o]|Ng?4=pծp;85\<˟*{F|l >.e'kG~Fo6i柀^h~y>MKx[H۬1iX!j)A _N3HLT#c({t}D[K0{.igгA!F1 "#族K4ki[)(,i"tſr$! zV.]L;o%js;(`\Gڟv?eu<9#M95h H-%="&ys1`UGCMD$;Be"vE4 wںCDO(7cpkSU uHacv ^ߌ~뱪S˦~}&')m'E?UF} c׻Ɯ\CJ9,8s'i7C(x Y̍POk;LC &o QV Rm.k6y|\"b?c{f->mdj>vZLMxpBd B XG*-SJ qqvP`˺bF#4La nr:) 3_۲#bBz}лQYj[Hg iGh}`N`}Z~[Ǟ%L AEB)L`fQx$KdhIx $`?ϼ612gN"WHUO"M fl bdT7ϖMqƍ[LgR54N Tkv̆WLāP`(t=ӱ/Z*.PٜTY@bB%rw C*&$ 8 ,ދgLэOGٜɾC (pks$.TP 0Q3aUm|~juןy Lgέ͈Z?Rw?udr,0@Ib[)[$9҆{=1pFY ]Fl<6̖`lQȆPqvxj-aƊ Zf\ {S3 ,v(V*r-F_ºYǑqEQ'SQC;޻W@e3eVcaqS6}Ymf,w͍AmdѠ/QT6j0@LlU ZALk R#OAZE;!}}+DIRf#BƖKN6+̢|쵄3ff7kbķvN-|l஑dʪn/W[Bؽx7^]{=l@,Y'4$e \wb:WL4@Sh"a֭8y`}.˵Eob+'rzU*#IU]ABL ̸+yvSt[U5rXǰ`"c^7auP6 Z=W>au}w9qr܀ Q8u |!_-@C[L@8gaԽ@*oxh~Y}3XW'hxT}G^Qdmm`D@aDЏp/O׳6@Pa*($(:iJЊE'`cC67b0!@e ,'KֺZmVAr@!b]uBa@@{G(&Sv hF˾۲RM@ڑdZ☺=0ӪERoO}^8rg@S7B$8M'LUP$[_gxx[^/qeQ+j'(s 3>G1M(dcuDdkrr}nh2 NKP/O}D=)['L=W`\74` hpϱ鹷zKC0ib7j  Gp -Ewvl#Z:1ܑAqx̆6m_-skxcΒI\]vRw#UEZZYN|::wDBwdnPD BǼTL´;c4Xd]FrA MCU~>紫hlwn::ب>I#|q99$[8n=}L!<*ç İnϔm>[23rżڞ"CtQT0ck齯Wbh+%}<Tu"y4_5pm\9@G%{ބyR6N iPLaLl?{ yIۜ(7?H%ř0,h?h| Pe~O{eVZX 0~Аvz,}>rv0]uiN*<_d; +NȣU,n;^@t[gIuwB6gR)\<{~T'-BXRm+6ЂBx < /cH$j7::Tk,΋{YL 5mq[Jk^WRwM D龮1`$XZ+bxX&"XTgU|֡^9UUb1`GD^8] NXH,Nϓ+qsz.1-qzK(B$`H(gd>G <|5A.ij0(̹W4.|.n*VV?Ŷrz?ye"@H@t aScIS9Mh3,RL> oDqy񿵘TFq, 9jUm.">M'm1$Ybu֒0i$ߙHQ MF$_X{Mz 5ʷS@`\QcEi8A4B/rU<@ :*+PBi|P::Rd^t=ŰGi>w]"!Qq ]7sN PZ,\R?#k84D F2j\2#586av:=Jo:N( 'WN~._W02^N]nra,EFq*]ؾ"MIG"SP6f^>UN~_hL{u2Z$b}^Aett#n8ʰCBSQq)Z87VZ˾F`f9-{Dcw].JL!O"YHF^9xT9{w$Ib-/3ݣJK7* &Z'#ɎUk+k㍾U8VCpocoN۵"a lZ*unZhDwgr0a 4Y;ɦ"ڃ TlʺɅb=O=[Ԉ5oAR+GԘbVbِD[٪\Ҭ"*y5tIQJOY̫OlOP^E2=a.&q3Sԑ(:VИ)Na4oe0R>jjOǧ=K6 pK;xH=Q.6 :-9H\^ VPKB.I-5]t^@"vYƪC"g 1%)@Ud"j04 cFk5)Yf)^b#}XQ/t0ɐ Mjp9+D1)5r*!&> "Qe+F@pJ| Bc ‫% l㭎?DU^<7\"f>-6%]z (?sBxfAcr3-*ã~VOSNKٜa'cVR5k;zE#Lězz0)āRȓ=s( LVZ(#f"UNA&ӛv毈Qk }n0@kh;gBCJ$@YShg8rzpWSgL%_YNdMFdv̅}a"o7/ 1[Xj{sF+g״: AV 0NS rk)#XfCiNrgHPSA4y|qܜtf3R!ص*YL6@x+v$%Os #MoFwh>*u}ukf:/vP Pmi5d7qz? +Uسevo oy2Jělms ;E-TOω&k#. +2YAPqϹX LQ(qcbZhq6x Ž{8\$oܢ~ԚZI}}~XlT!+DZ C=!*~\Bhd!"-v`vK'Y.-$H$w3zĿ^ߕ| Kg; adf (0q ܐ*-2+쮞BJA<:: .RD-D8uLlۄ24%Z|0 ׭Mq'0WCl[/po\mv('e\O,#l&{;p{Uek"r 2yujg!(:זo3s|?iٶ; yjT@Pba. o8%]o$5A:2:ȿ5ihaޜ|\Om% 8mn~ږm=Xos#"@ ?Ns&՜$S4sˊ5vZr;̝:1$*$,N&AdBP[;'^tGuWJ-emX6g#<ME fNѳtMl&Ud\h&xF2!]<[.{wE7>r!72\i3zsų,`.:{vO^1о՛2 D @JzS:y"}{- 52TwY(X UX]&Nײ[8$ a 4>Z!rWoWhvv")@ pv6l+Fyo0Y< ޫ dJ 9oUm3MVPAe={Je_hˀ-){Bȡ2ZSϟ+_rW n΁!o#w.K󠆹u%a.ŬU5q^]遽 ]a˿ ܶ%$T%SZ:j 7sYW,AحLpI@D:EBBռ_3Ыڂ(5ّL,xFk͡" >/9cJ棒FJ QA,$γq>.Ņ"tƐb[M-fO(n7A,q#Nu/ԑ꽛K&( E?o[[]Kg,ܝ[!#wĪуD@DAis% /N  UhJXm=]4M-60'InXo.&z+#M˚z_ڶK]~N}NjhoMHrI |(SHY7庒M8Km*4`׬LϤ>Ey[ =xx4y O7[Hk|\nV4u=,Q&a@w@MPEjo=Ey@FJ3| $+.=ICN=nȔ S/pf((p*}'<\,B/ _vjKVNXkĤU٩$K^WE~Ԯ獚Fq\Jƒa.V_a3gbgek}3n@d(/ȄG@ .Ks%p6"+Y70rH_}N`Lv2f|sKQκ%eY]]8gחj4NDC~2,:__kkDРTP۵;[Go5o[bQ6#L)."aK?'%G65 1,M!E 임1筨ح6o߮בkrSX?un wEcC`:>g~OgAlȪ ֲiF3J"Aw+`O.[&\RzMl) k#6H@UL萜 QCך40*|We}E@|AD9Pzdɋ="\"FVePʲʞkGmΘW(kTu}e冶A@W(g;?|T8vnԿ%̮6.E!1w{j܇ڦ/>EйNn}:U4Al:i#(&g-Eһf?׸r?k3qH@p GeKos r~ ;HGaUS)J B5`x  YhXG^.lj sn|S1_\Bn,螂[+ 'I*$(m 7qe]s\)I  K*96Mq[K̐* uA29>8A?ۇ&]֕W6`2QPMppYG :!jS8ɆĨhfRo\&W'6CƣS;i[wW]Af͂ݠPgGz tM]} ΅, U@`(lJ#2``V!qF4$o7q_Zz}L t^h8Us8,DE#KB\#V3 2Ѐ9 bwbJ"հ~FTxƚ[a q,֙5V2QˊFZؙ7A;k>7#?C!$6MIa7lI鮱S"**zV=g2Y(+\O_/r3qOl" G!wa54_2ʆ![b3\?NKiHHed8t"qpgú1P,}|^}ۦZcqj{h8ڋ<5ԜK#(fʍI%DÐU"v;)<ڻ<#2+S ¨VaLwEhPI^|!dKvF006Ss f'L@!cddax@e=Hu?o,7-( k;Gk0QN>,-_Ugk1wYCW׻<Q=Մ`Mg _'H f\UDΜ`n^˰~Gh[Ix'dbI-QO[Ф Ax_OG2xnIK6;L9\~yϙVtM8_)tZ:S7FX8j]g0p5z4"v K91 ~r'F&tȐ!m&; +`# Bw+GJɢ\A^'{Z7+yunTT85 iU%|Kz!v; AI+4͒7:\ .|\) 7v!U@2?p9t&*z&n:54ߦDQ{quc|9D!ZD_7kj0]cI@5gt֮J5RhB!5-pZ $-"k4;软XѼ  `6I q0lP >Szg J>q5`hŃ6 q1Ky] (.\9 ZDz`^ѮyW)D2ZQ1Gr`QČlq׊X3!>Gty7sK1cuTX!1]A\;7dX ๰R+A%\AG[ pjE?SLuVEBdDEr )UcDD{-;[<  Z*8 ד.W6|2 Wkο{k[—8 HdyhH;kVHR,mO yqi38Хljf˨juF?njT;_:&ChMMK\[Ě߸yrjkmn O2\oH2:{Xh1i#=Gh]>wtcwbVeK7m&\hbVjko=@ =s)A:)BL5#a%aC@cKGiRHUhzɻ?jРD^\roxᐺ28oYc Hh!^LCAdY! J5؇o3XeMYv}-I,&4I(-L(kZ$9\z׼!t~m_-e$ܻ_K̕nRSZ4OR]y=_y-]wzGhxJu\q5fFA˓$ҳTgP\RߟϲMhD4MK?3B\MwLVzuCÃ"[־&5^SZnݏsy9$(ge#=[DScI6}:oCJx*ž(cjm Yh`Y O']8z=9r\R<,n&~7Ai>=F8meZR 5a%)UsuAAg˒clq056oAXy %?Q6<)QR6W}fpjFsTǩoNֻf*ÆwKvJsv,Y܆Oe l>zч󐹾Z`\_Ϳ/تH_Nyx,YgWM,":N¸˹}6;xy- Uź ,u/vE-g,Y\} |L\{!"3OGeu|D/떦ݣZ@z ÛKTN; |%b(}ZKlc79O{+=\3kL{&'x,.s[)^C$AdAAkQa?}|;xdPE'  QM՚Cjn51 8"% l}ZmeIjNš?~TOB0/D 8I^p+i퓎=X ]^v Iwȩ#ͪh0yq=UW~&0P fYL֟QSylX*6u_7ߪ=by(.=+|D͝nT- C,* 8:M#M!lS '4;/_&(vYᵓSEӓCd{_n9ܙ}nl?,G<\g\ۥހ -C zO ,wfڕ0M+O+5̟ȑE8{B'_}:nuBUuk|2Ts Cd \ɥ<+u]k5a]Ik%;sb]KzUxXnC t%_в% tHK(-v,_qo %؟ mi. S a[vB^1N J T B@QY54Qzq])0 [k{r@e:dc:]|fG] HKtUZHW׼JVg1SNu6IɇPw;aky5SP1m d_=cZ2, oJHA by&2Džt )P8YfD}`BmUﵞ0wpgBeM6jSpƫĊUtG_{o7ߛZ/m>pW҄ BHMZr3&!Y<] ; uZF6`XMPOTL#^3f$1XF89>$T-TWi$ YE- =HGiOY?nwF-{:ң߯LϕrաO^ˣfeH񾗁 &_;cLtYh&+)o@)e}@p DS8RNuGYFR)P Q, `E211r~F+'&SA=qt~lYwQmz|^N'^ЭFO2 :J:tUaEƙ°nrHOBTz忰$_COXv廑kbk ӑu#9>1B]u@ MxUQS+cq0NiMՉLO؝8Ȯ-ML[)9l-Q5}NWXĐrcjǕ¢w|s (r#:LxRQȵo5)[U.~31 #!;{؁|A*q5L門A`GWTшBjqFFeb$d{IR&C*DTa{EOOo!o0o fSnM0 T_uD?"'M svmTCᥠ-j뽢B kGxȐf 9h6{Vϥgi2% #T[a(HN $S |"&#-6Utk{9u!vlKjc_B"8Ϯ+1?c O\\^iPSh=el}N-]8{<.(>+t^piDbzw|Q*f1bg2iv we_K?[ӁFFL_8> b@,%7wZ߹χ!j]4PUd mPJ G(W\5qQ($,81զNۚ2XHڛwɩ;\C}v Ո$x^3^iɞ#;,V%`Xx3jb墕U@Z dzHwYR/Gj-B%?韣Ɖ$ ?q;|d/,sf\fe; CN]!y;܀P`IB6?#uM )U B(@QP" YUX%  A./~iv:OT%9`/cG)_ KRs_ XXlДH9Mjxl KCl o;C P@uCh[?r ~HN7lDJz Dw0Zc{v\H_9:p,/b@PŬ1GvT+rbYvcLj'_/ٰڤ k O-Ĭ0z|mkCԜDZ&k +J9ƙ-jb00 EI}=e??ժ阁:zN YK)tȧֱu[[! )IQfya92J}m_2?؊ʸ3މ$ougrzT)45TiPy|rp*2J,FDO>s?C =WGF[,LoqS"stKJ Q o \Q3SxβΓ@E&h %ERL"՞Ft0!v$P_ {4R?1q^d ?/ykYgdnKo>EMzPs8.fF:uƛ芚LeT(_(?IYf_=aXn^?d 3KDOqzIEqF4$m(Z@X7..5bNx@ {H_WH.)$g)IX"l?]ȣC*0$hc{t8)DK>G"b@T:r~@& BU::I2O2ړ. t҅gK=>GˋtNQ# 3' 2 YfVLy?hY"ߢJyzY=V?]E`2Yð2"R 88x;C{Vޭ} H\`I*:؎ &u\sS!](tC{(jHT<#$JQoWV._Ƹ[B1tؔ=a|_Clzڷߕs|N=>eI!6z`pkn{SxL#h-es?5efv4%_YS86Mh@emO+G+Y\=&w{,{K{~;͊@³v'רH8 Z%gӒj۳7Bp3^>U-tm1ܫ!:o/K:0A4f8ǦID1KJYOʙx,ak8G2~̭ӒoàoL>5і|, K ]`(&}]NWX\sTot1˚a_ zHdږA0ϋ{ι4 (YZV`B@ q m͏n0)Âu^oQc{*SzxOΕA_`?KIp9uPŶ=\4 ntƺ4Jk0ƺiI%B}渓 y[)BxHG$NQhλ4%mgè?+c] .<K nʄ7$Lkih4gIm&}UE\S mLQl)F'PXＷS@VDm.ͬ毝%P+>=D9n6+ Ԣ:$o[c"%yBi``j6k[-7̂"% m p46b+83\iy9>F2cj%WcLu?W02I_^GR0=hwo[prI*Yfɇd;dmѫ) 筣[pѸ5 7l-KXy0acU18xp|B/clI%H/h d;Zfw" ߞCF|q89e:Ix1vHD U=LM1^iRs q0Ѩ3W.\/n@F-7dCe$ںZ} fZZa-}Qpz*H7\`nXa3.I9o<|ؙx==-Ý$(ЃVJUEf]6:rvwtoNx=8ZڰQ0 RAon|Rc!7t,>S={a|r e6{N5nu:S縍2&dXƐOkwv+(&f(z~Џc`hgb נRrIy䨖Fn Ȼ2;ꠃ .ff(sֺ.k|cбm g.|n>!w W:"!fK< QN㗋#euїTE_^1c0 -7C`?* 2_b1<%xtNALNRƣ#NG/e_:fb.#j SS>n**V{BF 5/5@,Z!L$Z3.9Dq|UFD Q0KZIC|3]VlkSaBND(",K$.rSIp0MhEr]w2Gr㵯He`L8\ 5IE&aj&\cGJ&** ctTa+"ta194Wv8Pn&)ո,u(50޵ gܽq V?l|-"^6Nk:_vJ7?MC[vChg4W,Yl$1Wfcq[L! /%U,zF.W|8wIc7nQ%Cv[S I 1)fON¦HeQWgc;)=y6Ӣپ6~W7#1f\( 4dWdm6?-1Z$2eMRpdJZ5dfb,2^#UvU,dd޲j%(?!$!yR;&*i:ttQ |G@yf`z8AH<-hmZ⧖` 40p5@+*2W?\s"fC߳aF(SKrJ*:/AO^2!w`}cZRpWXC=MƒԴ. Kc[(o3p[u1EeѳfC@;G莧H '"*3\DQdG04(( N6d2 QI{d;l4=,ˤpGlfG$LkpSn.&( cI)@1_ע+1IOqΫ{g*U!FgCDaK߃ZO}͵{{,}-бTeiC(EVreOPpKpyZ}"^0ɾ[*&CH qTc( rѧm -QU#. ipR r\8OhEr[!&Dz1O5=Sr]9]oR/_a>yh,+L*ʡ 8oVPVDhʴ80H-mqbA#+g:{!0I;|t3kњ+&o &%% @4'5 1vOYr?Xn%{ F3JIV0˔P|A T Ƶcc:~浔R*ЏN*P ,@pxbb4$!*h6[Ŏ}q?΅>?÷={ꌽ ỵCEЎT lDpN ͤWhNveXYrA3Z1)]cK,`p,s*b.SP195R+j[|cA ڞ[]_\%SMOh&DXJR`Z#@ = GF+#YZ53.ɧX1ثY4f6Eȁ+6$aT"KR4D-Vf.ElD !g TI= `ypk$$o$F̹}}3.BŰ-BRoŏrr]ۛ6  2PϠL \K0b!ܢzJBI X  ƕcPpJaH0N8HcypΝS,cL^,`[KNrp l^B@+0l"bjBrBjeEe hX4lK:ʇ=`Fj%I! 7^],5uyE$j\m@6FUsZ&IEt=d:؃#5mwgYXxU&.D$Mڵ_h Lýֽj|(:29x![])1CA] _j=8'W5iYʖa~V,"Ͷsr*oXX`a"^!HjF;`Tj Uk!;^K8 2)hb")3Idw]+9o;UNGf1%Ej! *8PeJEE45e-eeP(kj\EaZ&WDP 8luq/fvM%;.A!T`N Y*ԣ!Q  2숊b]6X9+hB٬otI'10KeFZLY- !:w:v^ #]mӧ5G(V,?#! - hK+` ) [X\L(#Ԓ1L%~"o4TԮ Y5ǑkiJ(7v[Ww.evb @BP#VlKQV"RTm`Xpa*cRm(<4hQ@ 1Bf.$r+V  M9L!Fys0g_ꦙ x4LmOKBW#' '% $g&I֧G7{z4|FI 7K';LP2 ka+(0Dǧ;;]L(@QN0i~P:LÜdAUv i9@c9W`q do48q#UAL3[ raSKwYkd`Up08$KH)GdyM|$,.@pT ,5,%\IF\I H0ϋjC,8lEBخ5p!@<-bd'1`[Bck€hoBJ! @rHe,{^ҐƢSS+)V8$Jlj@zZ0 T~VFID1NLPpZy U9k GvrSDTaRS;\'p1؝ϡ@8b.CHc#6pS "ɶ&*U-O*QXA H,n|XLFxQaeKܨZZJs"\{ ƺ(kepksbLdX]W,>e@%dAGk][1)` i" ĔPPbz*$ ]i1bmCg~[W2Bt1#a",⪊i΁XW]E9]\# C:tޮ1`q~d㝗nޜpH~J.Yj̑2U]*UVuĪFRpL C3~_}yfdh͆-{-3ɼiYXSZ2s d,&_UKBZs7U3wҚ_u5I(Q>k ewHhN sO ^ խ>NěqBDxkC.|9Gb4JK:Ӫ%kR1n6`h$)v^gDRh0jVJ(6Ax2~`]IMi55w5EQL(.4+#U=Ά6[$ښSNL`{&.NYX%aëqeaUW KQ75D͍{iUAU[jAlչJZsfx3Fs9\sڸ=<&dl M_[KDD]KZ. @ba-Gq$YGN S89/hqd4[ms~ip-B10&l2h B&l4*F<и`YLX*s)ٵbrqaNk7ٴ(F`d`]Al T$ X WϷF<[;w]$ȶۢGli6j."c]y@YY1$~`|Ԁd.NFR-LKċkH)Ѿ}ڶv%LvQk7@^0 QkpaOo /n]C%6 98cXHh]f뜚rBӧ 鼠ӆY%4eqc#5[4nx:r։LF{سX*F+$~]Eҏ !$ʈ_Eo6ʿ 5U-2h vʎq.T߻47ei rzjkyacjڝǛ<#v}@ظDRLRDBRAN[w_=bKL Q_҆>, w/^< 9C_uٴ-H&cNJEYCxF\\oU dק[ty:٫b`(% 2"E4 Sj0R /_';eHas.Epw؄ Y( u7g?Q>X `Ӌ%wee󐨜Bo?ۿ9 Em6{k>I.?KȘBHEEIfw+;[~Dbcj4J&gec6)ӡXBe}[% -z2&):pOW?]OMp {bZU6g+2;ثC;2PwjvOXۀ|)y5Jc8?#ɒ]EmAH-kd?+tQ=U#"عL6djl܏ޮᲈ+!r;Pl?2`^vÏHZZdYizՕ8pFF!9gΨ1BRBLgwrlQ#Y>SÙm xyXk}C&hM_oUFY#"TQO fA8vL1>v05aԼd,J|k HٞGyt[!Eym fqG=Oq8I|7YdxxZi=F0of os;ۭ ,X&7 oSp8Q(,cb"R'z%(>);IƮ:Nv*Uƽ:Ԉt7vbI +Hu|]vn#@l͊`X=m?_Z7ubD|y۔k >^ǫzPFGGmPgы~QH{ƲnӔ={V[P0J~2q}fP& <sYB0άD '! ^l}ԙ1 #A<~I_nd2pR*u#E:\2_^yvHdAOJzRAkzn+`?(2x kCLX*lNj;-HKl QJFMJUՃ57~VTmm& @Zuω*NI~$ p~81y9 }s?R?SjGy}Ni!yE˯5P$#xjģ~RS}_+ Cnk 4"]\(CunoW:9fHI#w)ϙkov};ō+7*DZaN2J~_48?9ѲgJ1%",vaUQ&dOТ4%r Xj, Iޝ.sg߿, "~xUܩSr{.nnQ=YfmafVTlsvJ 8ڻ3)J%P3@,{? h?7I;xZ13I|%iU7bB:!^S><)Ofm l)r0ΓI=+?3n_GWJ zlJy{{HY2֛U(G86;P̽Z9DY=!/#LNyD=S4xU3@U E1[.#c pJO=>ɖ[kIEz  s ao}HBzXRYIMiC 0L;c1o’jCGmA6 (CnZYJʎ6:8?i[2z(胋GD6Xv#])Y'Ji~s>80L%TɿI>:fu1XoޙFKH=XiU-PƲCXk\s9A`_uoP(t h ^.SvY+"% )Z B|ziwXf$0(FYKhMZL qsL? \q/0Z -=5JߙO\IJKB&--1t2jTY` 4`4{5-kH` Q $㦭$d|8;E:&^y;ZlWGW]ϰ/y[+ZMOEdM4Đ5pwGk9F`G1WMU|lR#m5X.QjxJ6+$K鹎U\/:`4UW1k,2p eFb &PMC2(@"AWҥ:u}/-w{HoaD`3PFRcP3κfܚGpJbL˳los%">c8@q߭wϮnH{&;6ZC.#+?O"9qX^Bvlm^rh_IWwvOdMH`bA76}@rJ0:-ئ ~/~^ N9rrM6Y5qDܬc=)8 cVYU  qcq3!2Eu!:y!dt%- $ttPnS)x<^)He*dsxg(<{΂yl6<!&90 omuUy*U#!09ĪՁHz$ s_[ [T:̜!6ˍ VH"*};6TEDu?m Xvhu Ɏ?.յǎMFhopB܅.8#~/;1~#f#grɧNh#meOez,֔\ 4VE<*I\ƚc!8ڰ + y0YVy#+nsϨas'햦J`]xԬ4tA.h^&"4Cj:ޗY82CVH %ذ ':S  >ngR]uK{z:##Q̦xR[7t(;+AIaeć .4yHfOeD㾫SRg/3? ro߿SZ5dgk;k/آE;by;o$滵-NBsZXk8&g8B5%6Q‡LTO}r`$Wƪ[b֢幊Y W` 9Ґs|E~Z;oMP4Uf\Žqc, VlI$bQjE.~z%i /h!y%b|EEo5ͱC+hKu1E!;[uKl ]gC 9XM0ZR A-D|g0n6߽Fü뭤srwu 'A`@!k-+*\6>=5!&`u?gtNƨ BL,b!3oV rB-=ib K2Y`5OjnIIj}5:ʎK`FI( ֨5Φ _8ۼVd9h:S'1Yݖ*z:>{WaаW6FQ/0r n_1w%0o YfJskHpR5=7X-姐+UEEDB'aeq%g"3yv[>Ɖf:$Qe*9>/|u2T1duf>3@ӉpaJaXm@L:=4nmq4z$G |dZS?KߚPQ0Ծ/u߷uBt 3 1xK<7怄ե[_Ბp ^}[?4cK>,ZivG+hqj O"n2m.H}K2]1U, jz |ěS-BnuN*0+02"L b|Z|$OWMZwfܨG=v]~YBpFfvXO,' $,Xl Uړ0@'v΁Z!D`JθD+.xjL9Ʃ-SH-EƸe+^Zg0[mNٙ ߏq~m?|)R }{Inja0_ήb "^P,1^J̝(pRgCU~Zꓒ+-FUY/9bM0bK'gRhp(TOrI wguh.Šf 0'Ljcf՜n#.8D ]99n/|^ap,f2[Fe+*+ k 뵚\cKT`G5蕱 wT2PRD6(gD*hx~RYHS(u"xt@:е=_f ۦ~/LAcjeYGcO[\_hi]aA3x&? F-$,A4 Պ0H֙DBYSe;4XU$ZB1ltQJOHh{,FqV'k..gCqI8c9/h*@&i>g`jϧa9wt yҀ&EqXѐD XɆN?7;!˅ .! )R^/sr?/VЎ[8ܧ+roww%CG NDY}oYZ81!ѷMADԾFV ȆJdHuRY!z1yNR @n;7:Gy=ׅ4쨗_WJpP, 0?g͟4)5A$I ?Sܬ>aQzX;g+4\v~iFQ dtw|Wp!zQ5DD,T IYQ+IqKUcPp@K `!LS;[_W-Glm陦j+;ۃ#K 3c%SK(GNNx0'?ﲜ(@&)LNҗz!_w7{?qCͫ71e򳷗x7BN+a:eT;su>F+[kS ]]R`5c-uՀ:O]'kSsT`X[Q'HBs+h(&mN*3ʒKwW íּVSGA&YR-TPຂn[ϘJc?xjA_Ctr <=F&䲃_f54,~…+.EZ C'V{s<Te{ DY1ɂF#}`֎י~]'_BP:dD:?v7 mB>]İ)F|Bj'U>k5@FYҲ qz(/<.ɫN1J/t~k;;%sy>/ǣ²%mS?>S! @3%4N*eʽ2, Ʋ-TFռAn8e{F5DmxeF:=}AL"Շ.0Z{??"N}ݿָpw)cCRVLJ2syKge<" ??Tc41k(SAFw wAd woudΆRXuh`%]$R [}rz@}R3F'ps۬}1`5I\] W^)@'%`-p ӖQD﹫[w)C3eKj(EX-=^6wql g,yM $[ñ,B(w賺_L?z?9C_WOhvGEh{K_yAwhw0{'wG^4 )!;՝3Q,#cT\9.C2@rg/ @"GQ|dӃ8&E 0~€ 3d5vy$tm==XO elt_o&zj:CC 0:|I HK;dTs@cE %w*8 -tXUS=pȄј+AJv잴06ďgjGR pړ3o @$7%-֬8Kj')gRL`xaq i]ls@e^0\?qm7pP8.j+A}?i0~[ZOd(շ=`ၶZQ{^IZx{\,> IPъ %֘`+7k is5u~VOc*( QqLvE- 40P';E4%#ݜ `T[(qm@Iڑ&'_ug.9>oڽTg_mȬ9cXU۝uK2pL#1Sfp[o*=ʧ,?р)kIq :P0HI>^}/5Wb#ɯm;ެ/[ YW(}F5_e& ʁ1wv3zO{5;<fUd+JR.B`l.!;@YwL N 2b T AIGTSdYb`a#-T eAU$ r&cxJS4WQ/)YWpp0YːR5Xa|I(^ 馪t)8P HqP$@2H"G}D-wV[jW-]5bP `w&xz_|o= /ɧ_ ?S Hb_4H H4Pt(]b01s`c< aM6A= #Zdž9#MڙuLt١SmZ8]0X( "H(JD q׽kxL^ݙt}Ѓ~o!Nr4p.ט]l}9J >E1N5O5pYj\:_7u$Ĉh^g ^Iy6/#!CP/?s+Ap%}18|ōSIFǒ$ K|{waFzzy ItЋa:=śŦյ >. ;N.,ZZ F,Hz/J'z6pR[qES e0? "ͬ %f5q԰[Vi_{7gn̒kd$!X_ıRKpy1C[XwqG9j\vi6aψjԤ; f$g o8P$bv7-T)dh <[YȦk$?'?M~A4S-Uhթ0ʙ,EEwgNzi d(Cjv?c2lDW:RDﮦ^tY\(v}s\ '^< ^ n xBk¸Q Oma'zJNy"TG9Q1N-7w$mCvHBھ>_q#)m+!<`0䒾|SI"R~F;[ɧ݈A{tBPƢj.;쵲t:h*Kaݖ᠁'T,E @嗣^ ǧS_Vpp~!# Y~GEʔ3dKGT &hJ#v0r:16?;l#_5w;_0wɗ0M_q`&ڈy%)鉢EKɱح3ǚ\zCDr{y2{ě/ 3u(ݺPziJٳ}/=>߃9ٖeu@-90nI('a7,%L}ukՓG.I⍑Kݴ$Lg4Y᳑B_YT&"p]KFܔ e"X|K%F(Vmɖ@ouU>H6CLk=z>yaQMlМ,n)y]mH@qrS7L?jKXfsl]ףR '#" Y$[?vu O̽<MlU`/{%郱p"n Ev6グ $$sA$y9~6?%NmhļvGeRdO"?xpuÓyϻYFkd\+s}r]qI%1^U1? kA,1V4DngƌOly.RLs!Fa<,qHfEP?XäC*TPޕi]85WڀaD.^墍T.8Z]cHǠmuTl )S…J%عޓrGYkS(2Wg6Nt5]וoP]:WbῂuƂX:y?nP}I΋&/41skܔ#^lB;#y ?kon |#nT k>}e\TA%i]7unT*Bw8j*H& \X;X [c¼Lڶ` HĹ7z$R˲/t?IEik(Sp @A{5ZvW8Ϙ.&>M֍nhڬ{i[:UfPٽ67 f ^žŗ@ >4{~Wuzl\Gj~$%㰿v.۷R{ggb$_X S^湝/Gjb(* 75TaB6yˋSXe?62 $# HhKN=O/7x.C TVBSX PA!+M-L]o5ӭ-_b"ލ8 Xr`/:/?{e؟Ze%kF˻V39k( I<|uTvLD=}VAnt* owfxJ|A&3LQAmZ2\:CĀF9~?{!vZ҄ r>=l -r'kX*Y(v ."Œ:jXLLDJ Q"uZ Jw ,;]||G?ڥ z,9^ J{tjN~2w]DHm6<ٱຓ e bS=FkG P*IZ!ªXAN c̔1/OR [Z ';'MDɉ% E޽Q7-%V-N]o]?Ur?T[T0AbѕÞ1SĐJn\R:=R2 (U:6fh#(]eMTAXJj\*E]6T9AɊU_j1r9[, rRx2I]KvXIAwתT"'5.;|fmX<##MAr bKC$m{a.gE.Hv0;W IG|>MیAf1B构x8ILM_Zv' da@9?tUpeĚl=3ύ6 @ b݇a5$,ͺ`)E\-Κ)6ꔒ*&q<Ojsx%OWYg X1J>#ujnn[Q*bF@ Ht_ iuB*VH;%4F7Ը.$WH63Rӄ'=%D-L$I-̫ aKa[-X륇<8Ec%d1 \+ȶ;3W'Zo<3%@4@4 Z%gZ>"H3`!V70%ag5)zea+hU&]z}U*{,BI5V_2*МC: ډ(JUѭaW\8 i`t"JhmJXE1  H|{ěP&5(}U@݊N&T bLn_;< v˭fA(߄IC Uvu<to]@T~D>u|8L̲8`(33%'"9!&(~]6Ϗ:Jzf<϶;&7T ̌ {?7;[=>K<_e S8\@緈en)2BWuzh!8lCۍ:820•bmޱ0{[3݀*̾M_m9oT|KeC3CY95-'s~,UU|_Ye[:sȫdGt~/.*ud:rHZ\PZXjF 7JwU0:..o7|($ENKf$}R7꣰Ŏpcf;Ŧ^Cv8e6}RZNqa^4LLy ͩXb6?7e<Rle#H=a}MD 3f_@Z)K|C 'E6:# 6tӉ&}@7( X~f2ɉD MR}gP}Sƻ*آ &4zCA'{F *=Xh;-_wىXyKḪ,M4BKD7 <% p]*!oeN|n3hoJh]M/oB D@%{[x6c>c؋=rg[[by$_VA7F7v:!X5&= _]Z/Endܔkg6rJʕ=c!XGN#+lNtek|l͎u|XsȎV !y AϯfJ6G[krm1 :49]'c$P4lklMaz"Z;Ԋgw;}n|B~LBJ9q(> T|ʤ~~!Pwn,Ǭ7&6v\vdDw[E\b72ўƎMB ⳽nv7igaw/؝ X#2&o-Smf][fµEIʓ-?[i.ymbkvءv"#[˳ !д_ Q"XkۣeH `x{&ɣbcsem m[!v"'GҖ~Yl81}a9|߷Ͽ,Bst4szK>fi. d,TzNM\'D]kH$} T#TDt)ҷ%c\4nSchJO0k mϜ̷XHHW{FoH16Vaik_Fcث.u8}L|8*NVr\f3&&~U~\5 Y 4V頰07Mxn8ds~S pX=/p%]6aCPE+ 6Q~JjV!뙎ƒ[yZf]D 2ZTl n55zӆu$KRv*5zl #%C92 0Rr[sߥ hܝIOW<&r4%dJB GK*\ '[Ÿj0Rl8j10 {8B8RH_cicI-X`JmxCTJN [M5qDlⲝ_m5'#K协1r^;' ř2 H?ʾu_JdVrx]}5𴿦 w ڣV1kErtWlVR k tq$0~l0PS_d)BW* wEo-FРC+LeDS֨0k{$ حLmJJً\Rqy 62Qg#x:.{BhYCg{@G*H sLϻ1YPa"'ZQ OO7ì5Z!?Wnџg!Ym6?vaks)_P! 4z&u >G6:քsKlR~ȤD$C<)$;f1t0c"36vUx]'l<}buP/U m`ɗTA݅kJp0'Ql 9|\ۙ¼0]Oj5UQ|D+䱑uE2GLqV*9)bvKJrܧ灈sKE0\K¼m8Ӯ.seJRtr:rt:dY'~ZDE, ^u*@Df֗#5\KTk ui3ߢs%TPzp#5wuMh&0AQXYKeA"b|\\v7x{ ExC"jHT?ݧ[IkNo(+jlyo|O )M2ouKs4:mƆ3FJ-4͹ҴernBWneL鳣&܅vEխߺ P\&<ֶbՏ.!5Fp]!hK[SHl>{eМ rFMwb_rbeO׮#hqֽP^Z h̬Y*_b`_}zH6PvM,zLp'Nl1/ǙbK!Uj3X/‡ζ4 =`S 鎫s{DWtowV{wE > G yaSh>"ĝmcZ74\1F翁q;ҙO s?* B|0g lb.5'w!ȶΪ#.,AHBް = J20dU'6"ha"Jѣ߭BU~^=Xw &ʎVdެ/M,/mݣm| 63V$ z*2U_- UR< trb ! Ʀɴ,o#gOUYښLpl8ti8Y&)ܳ=ҁeQ_Ajռ;loo&nj_KV]69_I/T: 5cbhRᄤRXkͼ'BJWrMe+5&kC¦Qqјecw~#%Mzev!ATsrs!0vr]MB= m9+ 2KHDQU4''s}V~2howg'iӐeJt0ZF~7umtT^D&*QE:gY,<{l?f|HY;BFlUB.i6j:oZ8CƤ\йs.| ᱃$"G6!ʱ9k̏45Sd,lV =vBoI]/sVZ`HGJ Ąlb_+Mw9zs} M5;zi:RF˛ζ((YXuY]Os2U>ˋZ2r 1,9\"\ZIA 뮠{s(=62{X.Ye&堩A]6 %U* ")-2Q Tn^R5}YN5sZUxx'W7D,i"Av&}FQ0a9,>"5䂡vȝ]KmuqGb;o%TtokصiCCX.4;c$rIϢH=M#lz]䱻F ]jhNV× zp?%?=g30p& L^L\S&k&͠PWT1:yP  ?i nҾ!sާY̊/A*u{ԥ8+Gvv~̧*7 ,d*dw-` qxG?*t0ET'GK '5rZ ;Xh(i/}']CrՅ1kMIS8?n"[~*pAMUG uXIKCLMA(s&tf,6F,@g:kk"ɉƵ-t1[ DuБ-xubn.f5(? 0Ik3hO,9Ta7MZ,D9vc92c )1`>ђ][y(+Bv$&NS29Z1}c '6-kOFmFt9- kԻo?SUP&GQA3jKkn૷92M!tq#)Uɕc1^ %ږZ͔Aqrrm{ٷw< q;vj-M)ZUFovMJTHjk8CIvhmjySZՓd Jt!)Vg8FUJv3^( SezZM 5Qd*xU忸G-V!Rۚ_ė]Ќ[lB嗫jXx#rU12 lqXqȜk믻BI%  "Qqk `:;or7j}jWGfS bQؚ/M)z ҟgv?8!u^ҩCtp--+zֶy#5 Ȏ'v}!ӵ{odv6"XFXLkɤS: IݿKx&f+qRPkXnM&-q軈X7(~f+,! w)m6_Ytּ]iE۵x SGDɨ Ӎ4Fkƙ~Te2W{ bj*$yš8H [>k-״l=z~e\P&fn[UT.6sYT{MA4[=?EGgœ.AyI7,h]6ֵ\@yO6$'lH֍.N7/nHjJ=Ӯm@V(xYH⨔ Z@JBt\hTYIu(_݊o#1_p YQy*V3ГSuOB>hm8 C6`OD.ci{ű,_^# z(3g!p6f!%ڕI: l[s jZXe1ϷHI:$,Edp-wOL ӕVT5C,9N%SSo:20 _-{;j88癩,& "sn%_jM$ыK <Q ‰d>Z5S> b@ ^__AkqLsQˮkYa[uk,1^ 1C(D*^PРNh# u|]*81\B@k(O]9+67Va#OczH.:y'O-87<(n#23h5@Bud*` AO(+Pjo@?h9 @0'qvxMhWPEH3ǜ<֯AvZ'wnM޻>K%A B}lQλ;jT0ڎirpGw ,V?yIή!!$ w1=~{9D4J|N'~x~n}l.*$  2* !&ִ@p) GM{ ~SON3O9d07 MqbM.>u|ʛX%^~brGfQ;V]k,Ёx8>a4 -rK9nʾS(ʨ!zup\nNQZg%ˏuZeX cioj&nkRc|~V"@!2TFh`aFI7MwdV.4Bp:b_*Odv./A*!84Bv3,vU؎)֙r9ՖanڏL.>;'mS;Lkͭqe% ^uE8"@XJ1 + t:hҜ}34pQ$@Y(cDػ(SkQD372u_CѭhcTiwX_, $J@jL.qocZ&Unnѣڭwzm!,a;~gڴdLgVְ) A2t62ꇒ 0㷿 sY  [hc(܋C99@K)p8|̄-gA(iEj"` rS _NW˴!;|e1ό^l0%cܪw,oWHᄩdDT#K0gGlC*`pT( W^4)%o]w)vaVDn, rbd/+Odue u];tV1Xe ۲Q% 35tĄF0?},Hc;lJ-$]Rb9/Ov#<`D5wO|/7-~m| Q޳ٞ|*:5O|v'mT >ds hS1,gx@ ~b:{>l?Kd~!%5ٰlvcy/旝bn!CjstNޫ?vdJZ!=?_KWº|Y4E&*G-gwm`M9?WR%>~:d9L&Tď7;V19?OeQ!Xm/Q(+dE$K[^'<S }پ1D`"O|O},Y_BmkX*~̗+[!$Ze nd`hH\FCQ^C.Ϙ]g^.萅ɋ0So义imo?t@uc~e9K_':K&8EaNzEbBgJwˏ]{[&E\ ?eaY]5˥`dOLyĨx~wjo=(ђdμU;6(—cf#ZD8BТV4ԗ]P6 q`&/j41<'6 Ԥ|A=:D$H@b‘[7MUn9caq_ h*ԗkq50?68Jԯ'i^^c(q$Jusov [{¶0#F:N5朼/dH;Mup|W\Rr0=b:d>*eV?evO 6= OxBevtdh foűBc.eOJn~e70ĢP[9+5`ZY[i/~ WzU;)]έ/ϛfY*vhur7J5SW֛Z¶9([6|7W.nI-opF?!5ߵt9oii7B7h{ #Q1mÊ7t]a쾙7Xw $QG ~,-XV6u3xSO ڑAeTͶ NםɨY#q2b3vR8z^L";&A\/t(hJ./៊ȱEm6*j9qK[o̢Zw$R[/"/sՑk֊DH:*bьQG,P0[yYvn:Ć r4-1d>Y:1F69XxdNd؋O9s[G&͑y_.;8!jpdbXJB-tڥ8tiz8]V~a}/¥|(:"̼>x~p6p.=%@4sRFDqG[rMS{% #~v-9@ 9!Ɯ!+b`A6a!Q q!ll,+nB啹YuUZZ&e^4rރB'g^ML6fʆ<=UNVI8( byYђp4Ҧs9\p ~f4Wzl'`zffC)q\S+eؐ| 䐍tvX_A#$b(}{]:Ln {-.5E 7!T{jl#uTCm5 4)F7N2Ie齖ߓ2ʋq ƩBq5i%/A7qUąH@D󀇪0nAf!Ͷ1ROp!=8Gz [P6A 3R&`Tl&aNW/mmfu4t@ڤtj #aߦg!u nbP@p$Ư=C@L߷(VL{~IYDݔ5` x;Jݬ(ENm$B5(|߲cUgY>=p+_~mq-n}^}ŶPb[A'^J|A ޸18OYOM3fM馆P_AO7Mx1faI&'Z, 1JDU :(cPŽT{ZNc B24e 1-[ܬnN*߹(BKK͘f*T@KsjI x$`'7sP3+Pet}c?Ool_S}S8^ai+XQF`ݳL;w̺!C1_m晖i_(0x"D1d Cھgyxh.7Oa?YN䯉o9 ;̻F=qU2IvAOOi}T?\j'ߨ|6)i1 <=os) nEyў{1y7p܏$!9!!>q1j+!Oxq{tAk9 ͂YX-iʼQz >DGoi@i@H3d 9i{G{1Ox{e@i(r":TpG*BGu &1®&t ?F1bjFxfQ (dA$R(B=4?%&Կ;"! ΤD{e,x"{*Ɔg 3y n=+\c;Wcc2׸6T<~^yzD sk 舕,!0"E$&jmxmUQ[s_/P'Ĉkq^T&U^7|V ;mskj گkCaP1G_tK Xq/tٵԥ.9k̖A+L@eƐR( 78,rNK'+#y>فl`XV)ߍoVa}9vHHV&u0Pw'&RGlnϡy,8ry)]^ClGmZDErXRJJ%DD,)]N E#Ngo,G޺$tڻ+8D|\dW|#zI\2ZJ?1WrTmsxv#EJz۱xO1kFq{>zUWTl~][{tIA dT1(2ҾHI]3}Rb/^ j (_ [%&qGf&>K:aE?hC4Fr10l2f*a[!aQ/N0BW szz$㪭\7PKak?a=,f? +7QQrw0uÀu:A'!OÝM"PC#}Od)ahΟ BʩwY4;م0&H T]6SD޽11+ y4D~OQ9qC^._X8:k9*eQ|yZg[xvERawPX֘3)8s(teTԆs 2.[y[/ߑԤ/20Zʚ߼5%nux8Z|폓1㓸@, uDD!"rIL#xOveğJ` fY]L/]X9~' Jc-<Lb  W^v ndwA0 b≯if9N:J,ji&e\E$fk0an`>~a /Q[ a77n~n\n,Ay(@DD+ET@KhL0:i0tЂP T6P*IqQ28.(;Rc^4d>1KO8On$Snݕ5b93NXou:.^.ffg} [r񪰹bYOjsM:>o=3?iNlE+ %[~:WŏcfJ~UE|͔ JiFH@ץ-j $+j$T]Dz:/µn(~waszz>W~u]]LI1 ?|ǡ'0 6' mcn T_ә??T;>"v31!rD1D<6TeA"LcȂkVE`H𗎤ToP+=X&%K2 a԰*ghڠsMj!@CI0f{ayTk%|9åZQ"* ( EEu0R%&r:Dn-GYf^mspp VMcc=+ēNbSC뗱N깢DiA@(QY?q:`?@GWe"e0Bv %>4YVͯ)_;/4E !gY=ATk,,(eQaþԿ!T'1 =i%lN;IЮ MLlM&Ұ Gp6bDDfxx gEc5콓W6 ~uPнY PsXݺsZrڼ9:E4Yd ZTle5e8MS{<°c. ~oy1XSTUA K~c&i U}П6UM6gW= ڷu2y{>V{gV(KԁSC+=s /(S7i#tEkG05q͛p| O?qR P* Y%C&<[} G+e%lQQ31CF 28)l5DOQME(̻_ zAoy%8J&A*c28庺GN%YntksrEUw#V:2BsdV龯Uw~W|S<Fs>R(5M/㙡F ָľvccwCkNWv~ӹ73u&K Ooy- 7}9'niңob COW'ɨkfz ];{Q]ї+F)VsA|udf6Ao y~kdJ>}8IYp*ۉQFU!i*9+%rCmw1FtU'_dNF46$Nv=En8n Vmܜ.wgpt5e39ZqJ*WB)Pq6gRo(|b⠵ǰC"^ı8TP0^P۵YG [ifuqixDK'SK-$&2BQr̕ZX Dr{]e4;N{g?PmNqCpK-99ՕaT*~JAZ0RnrjsD(f*rrdXmA)S 3PSL)`չ/KYJSݖ$6XCI ]@@$ yYQ %zv0D-B>-l9/Sn߅mj4Br-˗:*:,Ne +5U5$xNSj&Zm*D.'Ȫ!~Z • \AB@-}Yym)l=gMj. (b.Uq e]x,@ٻO #wLAbq-ڰEnI2OabdGOTbں{@C@u^-C[j "xJ@SFp9\j$nD]:2Y޳5],'t_kcj5)Rٛ8IYeófg 0vL3l%˶Ly4]< ]TP",kܹ~Κ#!aCشf+Q.cW #7tF8) oh>Xx)o(:ޯφOHЪK3Y:O\-v%89%lj5 *EÃ)TʃdXP7k$k-ڊkd9 ĖC rwYQN#z\g2^Z-˿freg{Z֦>)WgdM!i~Y[NN[#juW󙿱_&: ~?-6!ƎA^X n~_s\F]gsTtGy}>,gt-8n]W6̝tn(ubwo|2rk$ qPnH,ADl\HQ*()X=NGM+׃;\Qc^ƭ( MDƠTIѤгj@yP@H(֩fխ懮ҫ&Q6O^.*W˅aSgyD.D^Up% }_{o5(m~:?2u 7_ڠwlĦy%@^k=!lӲ¯ŏ8 }Ly6V|zBee_.37T"ght!%$a qxɒ\DݻgxzF.W7"g5ٽf,^ek6~BWRnzŲ#v&o,A0Ep|_vE&j!DCKb@_NZWZɉ_I] 6,CKP]xZl"m}>SVhA`6m,xH%)F^wL-M<K3L%/8~ywFKJ"~|=y~3kST'#UZzsԒ/2e_5)W? zBvR~HDH AƁ B;בdGrM-v43gZPvxSRآ&S>ݟCJ?@]69QrCGWw7ѶUi^8xQEw6*`W} e%b-[drT1y,(bHI΂Ě QL@@‡ӏ*Iw@ҡw ZT1;\9\A^GpǨe&!y(C9pߣM"am]0E#$X)6 ,lUĹD9&8*bx;ЂÛ-h|+˵_Pl\9&I0 Ã$ u<兽ϣͲOdR.d84+3}xm/{*8l~E{(6+ E}_ Olf{OVmEuŗC;|#-XO|ob˚2/}:c_Qwh5wi] [xjnc06'؂+vfA}$"==;0t@ʻ`% [ TH[(D+nW'Oa>]^-3t&k8JX>RwW˽MGcsԜ=.쿄uDCǣIBKWtHŒPCDEʯ==yd IQKKq@xB۸"-2>w{ _> 7Hb AJ"$9nݪ@x!E8ܝ.}=Y6~V:w}3 8'uq/]Dm?4'-bZVR4D+/pb3pPDI$)8"0FNIRƓAz=CrvuUnm^yK~O/iY+fx);.V]b KCW]7ie<փHc ߖG|ӄTJ{JwI 2sslqlZE@;9a lIӀ}dGʪؽl˽:Yz_":pø/{E7?%P5i3ʼn6>?גfcZonwD+L*4%/}ӆytƊ /ڭ<<.$*RӜkxxffjj w_.=l y}cKM~v=-ʆw4VQhzZ[eg΢业C.X9v'a#e&fo#tz7 Ք xSi<^/,:ª ޤQ(i!Nѵa5 cH-C)mL^г|'?^<Tsi2.%w.Kkh2Gسft7; ʛѦs8xO_*yϭs)]WG3z\-A7@2Ќ : ]*jB]2t颮#\pWoga_wg* }n`aUYC=Op΀`B b4QP:[  e|GT/{w9}?רϏ!s6fPycA-ѻ'c:OF囐tdz1XB I|>f^EM֏3~djK(QdAO||*u"MKY.&Khhi9ϝ\p=fJhhzoCtϤ[h0U'Q6H*:?pX5} uHIbjs2d3ޝW;UKE_|]xs/>18 w`ru9;ҡܷ[T "L-gt^.CcȋPGDRa@r0c!!,Fi]0E59ovX)' zt&mDP-z|P:LbNhXO( >zA&W^ jVcUS[u}N}~UVXwmyZ~eJ ޫkXזּpT1r w{.fU+?^?#@rcU8ڛ]JOJ|Xw@TLy$?o'Y:³Z~'U`E7&֣Б!MYl\z4R0!Lc/Zذl`R"i0s5}Zk[b-Y +)KaUo, qBmK3-<[Yi\ɺ"mph}]`h8ʕ4ZMWÃQF0t7pmX+Zk&9'uR/7 !ki[8jطƬ1.I 3B 0G,ʡ,Ă ez#E-) JkȘu'p)\̼ȔoIWrvuT1AfyF/?:"+G:vt>m,AP=y]wY%=m>Sw,bmjg O(|7 8_c& _2p{U4zū&do}5E5 w6RJL_㈛]n쿮ޛ3GBRd2 {f lwz·6 IS `e"BYA޹kp19>u$܋~u`>q[V/OUE;g-S=^׋Ft.8~ ~LsMgt9Jh^0Ait~5ʹ ~w2M9D9s$"P֕i Xގo|A~e9"~B ?_DB17t?qeL+ٖMx'Ú9(?Qӗf{5t4 @$p)WlTLFJ0LOEZ݀}o2&FTTձeSߵB1 B$Ep/:W%'WoCf?2P1ҬB**>ӹ^;O&!7$4a*oR꺧mah6$n&t lSZ睕aY]T3yֳ%5PJx3J2_C2cm@n=֛qE R6=Ke;͓]j #V%L8-`eZSxK󒻘-ߢºmN^{,.Vp&%n˾'ˆrguAI׾y~B(maMQvul4t~d#nt!2N KbQNy,LPCM"כ󙲡$<y0M&-!l _)4U߻H[,B+%pry۝Ղh(M9Up ) z@ #SY%xܯR>sġ'x[IX-Ã;K?-,y֓Ox`i˶+Mi- Ci oFZ{S4jJt+(]\φMLU0/ב^P+Q:敔ex> u k[|oXY_UQzŤ}WzNI=L bZωlfށen1Eroު Vɻ*5i{]y՟2$Ća2,!eiGIND |&"*Zjn%6Z_LۮԵcd{twAvj(_ BQ` R<}0 8I`*u/'Wcߏ/g(HȋYצj0FuQVE)J|9),mMMz?n'sՈ Y m5)C[*,2ɖb!\@(ɸ78)cʑ{qBN7<ﷶhA[:(Ii?Tь@~5-KzSMjd J+oAy!,ӏY?Mޘ'!l syN| ݴ(%3V[ЇgCŭ jN\-2D! 41E>#Rk}9~sW[5m;aagخ%E+ל+sY*n^%uG!ƬI1v\?) Jx*n+uc\ Fс3kSA/Ѷ U1ҵ@-+%="#p`PzgĦ{EʉVBYXlc%(V+ltN|ea%8Z zHK01-YAXjd#\ְa>HPJ x^r0PiBHd@{ ^ҙFu)㲕?{7&{eɒ{O?qaƺ?(?^dYVLo:_#7g~`%ɭsFu&-3,("6.̀7}fADAa/"ä]xbIQ1(mQxr4tQV*FS4ʃZ@}'pVJ|o4Ϳg~}K*6 !|?#e|Uš)IC=>Mp"Jֶ5[]}M%J6(@nHe\En[g/@kp8 dV:Si%Lʇ/ &Fm 0DJy1$ۢSf4Ahor"Ac)!ÆSƖJbPލ7NoWD`, u)RזwF*PW#tg(nK9W$VEXL1:U{8nk- ivoyqncGʸzE86 KކaY7:0[ P\>F>iz=H=iM#UWFh`B;lȼe 0dE0T liB'}~z ȏжb6EfG{&0u' XrZRBܟ8c o$:W(YsFOa!Qɧ ?T1ȃ9퉜 q0&lx$C'2"Zb!CƉZ4JJ_?]-FTmcH:e`4n(i!%FvJ٠ e7PpMg5*+`}(j,iyJ ;z6*OF ƌphP14&6Sŗ_\UdC*YnZ3[PK,C֤2yɗyzµ )o~_ uEܖByjӏ݂sLVM=ɉtaNimE0R7")|f6 HS¡r0?Rvh )#jF[+ &@q4ZZS6 Y *~;._JmXn8BC ŵإq Eq,O.Ch^>#VL W=0PAEh,os-D`g|{gi%kՕYB}>5]ctFd`S&r`1]8^OX0!t6k:oW[^:pӃƇ?{lنH0 $uxNq6> ľ,8Dӝ,rMO Ak:d2 j@as!5ֽ2R=wu5{;oĭ52)]*[):8+Kg1Tgbt=''I ؂0Nzh< d EsPh# #`Ќ)@^?@NQo m KdyvOMduZ1^43g5 ;2r=X1d"(46 Ig7zCzyL3IL&lYP3zNZ4n4ϓ3܏Kjt__[@*kO75k}{>!j"^ aJb_1@A{S _ĚAgTWvfP!Jt=Ji+Ë"zx=½/FfHܛma>Aczr@mrY7.4}jUj'@zZT q4?ϟ]O=L'rRA#rL7 b!Q7ÌXlSJU]Z%U.#;ifoY-5ެ4aӽεil6oL1>E5ac`G33wScXЯ*OUR 3@ Bpm 97W5ܪז%# kf΢ /^K`X,CVAB)D}j@ ,çݧ^ra.BR;hH+E0wp 4~owz/gâXb ě"k@mѕ0%54X| VB=6:r+ߙdp'>e,3E+#Eʝ]*' t* 4uӂVDۡ@DqB1PVqԐikzEl=EVbk[n`&*DWʲS)%AxU Xf(IU˲˚%>XERGBN/NYĴKA(f3Or콵/̢첒ڏc+12v,ǖުn`ulÚϧw ,4,;,a,Gw['O͝F„PA_!xRBĎϐm4bu pr,m> `&F+#˜.&_o E+U-FElsC{n–u^vN& A ry^VaRw2yAemSLtU9+]j%]ncJ^hKLׅ>q m\+,f??65pbq!PG $[ $H'w쾜#[9IȇA( G/ *ʑR<"Oyorz {l?*/'S1kj4y,iWj]+UxGtߵfXBkFЌ y'e?@-? hs{Uoje'/jtvUcsP;Fl8-2rTnD*<{Dd gRոYC}}t D'S?:A o'[4FpRʹʄʦ9h1"\F AZ1qpo2)5 a<58IOx&9Am p?3+˙Zf4}wƮWUfIh5Rgr-n!I K,Dbofqa+&9|䐻1BcmU/Zϋ>ʽ*νPd/[VܦK2:+0gU*/?M(lXt}w J%*/v6<7cŤ$Rt9ouIUP*!wZasYJֿl.)GG]E)SNjK1tI*F16U,2eϷ66Ȼҏ7@XMb`JM: =ɐ+a]#*S ,_e>&ǐ~Ouq!BTP?xȥ*;j~3wIтW=-<Vcsާ>`(@ w)w{azs \seb@`xЦasQ3neLx/j",$7{XōNJuqp%4&TD|Z+vmh3 +=SKC, -q&)[V=v}kHg$H>oȀF3_)`&9g¿qz*:|?ZW,Mؽ}w缚zKX>6w3#ZDf}rx}G)ԞG2 8 CwOcp`ScyFJ!@@$PAH)R)$Q@YB @"xL>EBVZRJc{ yC"@nbЃLH)ƮՉ AT:b j;xsş3Pb@~"EzHUy䧵lF!-KÈE%f$rņ6^Ain" *9hTŧNW0 ]oivsK5߭F?#hװ"Pp3v44?>&!;9^Y}4niDU=׿ᚠ'@]A翊&PYB=".u(/?41_؍b8~س ?U# &U-Y^>ɕN'so5LC9u6j1h."#(#Zj=s$a?}9«88͘hQ'*|QCdfCYL;י5I46 ܔ9n QXz?PvlmvUs|_C*ҳ`CbBkm d-NRN=wKed5`g-|V_ݞZ=qHgxwکcKX4H_K!wvr gDۈ0N$0iWDΛ1Ur(qр<1f86!Π6.t=b -'L2,R'6B {Hי ފPyWi-:|?깳qYlKcam0rU.~nnCc+>S%Ɋgиf,2QѾm@[^ mP@_[/~e ,;*ݵ[h.2_H&-1F9~\[gXbyBqj|0cyY-5ދHh$;>R! .#uGA`Ko4[ S},_n~yn_ )qjUvf8~iKc=-s/31? >,_#W) "<-#FV,Og2*u}]Wdĭjlf\cSG>L+Ğ^:b漜īu9+k\$j"t":S&Ҧū:ŢlYµiqJdT2=6 kBR8T 5IWLl  b h؛g'sF r@*ȣl믍c|cWUM7=Vl$Ox=9`zB$ ǔq9W>}VݕZ%v~t Ig8,V+_^·AX%`q?LK!bmuCu"reZ(V8]-p1]}~6V3)<"V9u'|AEaR!R\hVQ壖D[s@>"W8G!G>G mbʋ}ac}Yj#/WіH_hꔼk2۳H5i#>hwC r.֋$fTKtOk͋tc[dq`g}>%ԊCMƵ{K MM[ Lu+g6ԩNYqa*;>V }?j{KRG#danG/\ M`KKUq(ȱx!XF ЄΘE:-?ܺEܢ35 c̝f:5_#4sKx '@Ak!Oj3{u] [AZ͔Jȉ))3B͝c搚6pz˙i*EUMa',.y 6L6A2:R<{8rOaS #fM[RZIs^EIm=5W`nu|6q!8lGm9[DϋB֯CNb R MŪJ2nSL:wCvJk++Ƀ"G޳>ӵx](#@sK}Kr5[#k_i#mIdG 4DN~k&$˜L-+BB`! }#C)Xa,'ȘHvq6KjĊ{۷geίa:" futDȶa-yE<8{ǾzJJ%k/:~}q(n&B_,VŸ ; 5v?N+" ?v?/8͕8(Vf \Jt𑪅i2}`1zjvvlʍ5e3'ixj}puU2&IϬF.A0Ce5xV|zCGRk(n62 %U%%ɳ~lXEqs3kP$۹tlXʍ$ߗPe-R!L؀_9,K&88S@XH0S$?9 dv^NKN'>ylb/ܕGE1PeaV2k jT R]]0w=|SmQJ֊~Gwdvf!y=(kzki}42pmZY>Y$ì%FJ1*w)b>&My-OVpm器LQ`k׉b2i%QRk@C_G +%׏r"˃n ^ 8\h[%8V͵W+WQy´V["/;zk t? ^Έ x\I*G rnI/B0} j=vfk @9~ͧH}."TWo!$~YKdFVRАhG!v-]CYLR94SQYy@B]^Xbqo8ܸ.mPwtG_~^` a$=7vuw?2,dLe{;nyu%xNoe~{XPam *ogr& ;`ڈ!1 # ِ<^9[:Z̔q {go.d5[P|VpH}p%fFحbˮ#:LeP;#s:S.tW] GJ|w+umN▂k4N߳G\' KQI8I+LX❢LJɯF7Xt%$"!n !-,zuDJyyƶ z[ مBCC4}3iW'S|WJL;Ah\ :*M%Zˉ B#CR:|7o?GMs eW;3܏~̓40})A ku{Xys0d0m̄IR.6p"X/MB#x?bUka#5861&G;_K<i[aW\|Dm 5,OrV$-j(2Qa2O8.lEn!GP,.9Ny52eJG\xuԭujؼܐl3_GъfmY-ZmpLw}fG);xo*Fr^}o[ :Bu?gcX9K̴IðӭI,.nm !+pL?M/W^N]I\6NҢ'~ OZԩ (RAI$Q.m :eD &~L2/JˀRč*SߩFz+S7cC]2.qmoSkȉAzVT;x2D+^Aj40`B pr̰'Htuv^݈= HɍmgW./%>^ݒN_nBf1qPdLqXx7 7=\6e>O0PxoEsQAs8E2ag,8V)( r"Pe8w4KGڎ*oМe|og"ՙjA[y:<MsHEPQq._sV=喿s;&@ځ!h%J5{)BO%H?W)*rV֘Q]pÀ D ޘ8M$;W8H!jjHpyYzF4 g0Y3mdvI>i([UF3VDRZ`.T>8F)Of Ҁ4t}IIRI8nV>X/NXS&'g-eBsˑ^"BDabl+{q 0 ć ?]q'K̜J]Dkω9m~afpw Pϓ"$.>eO!uܼصqjLbڲĄgc t o x¿rыcbdl-"Ԝ'l!t|eFi~<QNG) '%xi:$:u*C0[v]d=Um &{FIVߗJʚˍ3d͞yşsEX i yzThm{$\ĎVĊ< s̻/c{!$sQ͟$QTP&S1#Wu^= y"J+1J2yKT}!PUA+̄JYK!uUK$K^W5..}Y|"b-Ip)X:7&dkbA\ИƏrx3@Тi֍"xBȜ^a1G<ƓED@4Ewzˋy+hDYoڈE)ò~n; 6*:ec't^y8l,??sg1ypL4* hA,\ +hߣb8$ǭpo"q/ʋIOwHĆ9:L$?aaiL&R{^G$*U9f0yןٝU_zb_n jWҼYz=f4{!ufv#v^S2eLO,9HVs"uYX+u+Nҡu8eG!rB}eLYclrpLע9S6fM/!pK,Vk4 4@i [z߬pK[_Q FAo]n$Emþ7QEK}C,iJ}DzkJrˋď WDkZX1KRȦ/[V<}884+>T; !bX1Y@nKca0o+|T1}P8h[>CXPکJBc}#k%|KQcS|Av uT_"ꛒlAqMv@S*40\7Cb"Q3ڝXzkJ \?dx ;\ӦFTDB?PWY'T<_0˜I?1Žm 4Fx~mGawW[2UCDApl doE6%nԂIZCiKU+/=s@G B@<ܾ>߳ǔ!BQfX8yw4~xG8|'hi 1N|^6[ߧASQ xplh.={!}w^}F.X]|WMkwn4[U )tN>=$ %ͥt=\̡p4ls~CO@,C%~O,FWxÛQyַݎ)7B`yPdHW'spϬ.iGuٽ )Ekq?dµB8jVff> “QZrVNKw,a4F)2@!I:sX%!ջVҲ%C[UиakkkƗ4Rn ו/"^IZ;3s+f4L6&D % DCD{-Is|G~9Kv'#!zq-.V1"#wmg5jrNan]R{?1&N7\s5b;>,LzM0ϞfFmeBCyD֬smuš~MEx}:8&EF"A8yǏ&7A`qXn 2scV96vfGXPg3n8hu20&a߼E0G`uo9id]crj\bW^sV}SnئN۱Òn/ zuk_CL ڣH-T;k'/%#z+ ƭ&-+cS9'lH03;/nf0)1P  !opS#|M' S]kj"6RZ]DK\v0v4 \?G &N4PO?̷! ۳'(޼Nx(ț lRZO<ֽ֮4;4JP "h=L5 ֬L- <ܥJ\fU j RS#%8r)Be7yK'=jוHP].jHEx#ԉ*0."$Z74] iHܡZva H-ޮO;`}=kG͌vf{Ĺ~!Sͦy#K1V[|Ed~vmNQRҼΕ!j2Aʙ N*ʧLh`䮦K@9ãĥ5>/Tք`a2[¨{ h~,PUƅ%8IK;Vȴ؀ˤu26f0i/8Z(P $`zMv&)GRi{W^4sx_C(ikgbAa4u A }ZguGM{luv ~UMuOEžmu[}Cg>_AU/'[OV 9%vȢ~}eQXIW=.P@Kh?O3ɜd˅o/1{;[ߵVzo Iuk9ĸh~\ +h,:g9pA3Tax@!Z 2.:ZNLXK)V;|*N~#X~QӴ!&Y) f2t]̊i٬nR[^'%Zb>RYv]NAءU.~/a$Q=o߾/Oy=Z쓱Nϔ SC'ޯ bDu}v^ KytTdvL"$VXfst.}(yo̓F$L'io^d $Qk3䕢JiY nad}8]ÑQ/uN[Qb1ijl:E^?nk{T^Cc}?x׿EN m H-K9=l}~ۙ.!SMc+⻹Ηlu`KEl4NJ'|<7mK#UY7!=oc.AΜ>NKޯ+e^vZWmH?73㲘^vhpBx9!_}ʠ~}1M,)?[mY$-hS]/xؘ>~/ gP6.PU|[p1s+0$~x*-Vڛ`@5QՅɸ\RBCĸo7[ʺze? M_ |wk„uookwߥcyO3-KfB#@n߿G<(|]6C%@F{n&*O"ba9mIHy=k]n6 z7ЛM/\ƯkEӰ}jeښ} Qc!m>|$7d2۟żfz|N4z'??Ә$2dU⇙,qB" a_J[Bcz$[ev߳3 ~+&樂]B/s_Vy2Җn_ a?)>D_̥^w"=?Qn!]x7nfsʛE֣H4D!Nޗae^|_o)J }XN/% ‘՝sS= $֗U18.r[rz'Yη(+'>[^G_NK*ܕ,*v PDmkWr_-j\cԻa&^qKU4F'{#1QY0u%#m^.y;p%*ٹ!&(-unxEV"=iG:T7:rJ)WPNuE;9飢TiO끽~3!uRS6Q~GE%;w>dQ9.{0sV㮿[=8dzOL]/; DUVhT]9xK'xvP27YmWZ7PJWҤ,DžTr Ii!PayN~ט(MI$EY ]$W%2·-0R:~7'{OƦ7~*":?@ AKW㟃Y!9v)h-߷Lj{TiMMG9 +96 #& O N#+GCΥg^ih|9&{EytDolY߱45O*s/G hylZf!XPi\]uMn!~LHLԗNo{r?XePU;c[+m&fTtq]E6WWŵ-l\{Pջb@%"2vlLt%KӓQs.;ΔyD;9;plIy M*;X$(ECTW3)$h!?O~{$v?]DD Vf׉R,B}okG;s S] v׌z=k}L޶%mr;H6l tWSԁ4P<ܙ hHH2])cnuX³(=iԀA0\Dy`vhQ(a:@luF"ʃ߿jk B9zH_[ }2e.!UBۚX!; +|:1 m*!kz >upFx[ܘy8ԪQ ZېO&>8w$&)Ub *T4OP#2Ĉ4 Uulj{͋\ P.]Kͦm00 ˏN`W?PPP {Mk(hp~d@8 6r,j_zau;ғ# ̧o[ǵOam148zOP*@&DzU- g+v]fˤ"׬F]`#j˥x)ȡXa 64΄+K[-.m{bT*akUHP:FEݪ<; 2 !J ÜŴ3s]qFkx5)CyeC '/:) DrŐ%ID ^}Yvs D /I$2t@ekT;+7DtR )QqTޓTzNjڏ#t~WQ6k)n?5|GeFJR++G^aVu0h^.#w**A`IҤAox+< hf-JCUqsxMrlw9 S&ZzNK&AGj)NiKqS `mm v6wb( aKs+Y;Q- {OmkSDČGu/ \L2DA˙n}8SRIΏ9vFĂ6Y2$ð ^JZta@"Et QAM \m ɛ\ՏȄiآ!g6w ;jk1y=ƥx#12"= !Cv}d`;K݂K}åo[˃+dO@cڍ|AfBJ" 9RD($R;Fb7 D;y{"rA,EX)ά0yYShk m{#pNsY6>t+\=_O9:a!/S~n`Q=!g&lX8۰eAĐw@%u NWozGyb9Y@o! 0/ #B|C{XJ kA]_&ӁK_ZABu=J!L(PGa G4Ѓ-F'lg9Ah_QӃ+hQ=9ȑW^-ܪ0ٖ0y2f*#@ZDb#xW1S`=a(r0U] waDmF*?G \Rue&q+a <+uUx7l x<:g(WY"d.|ܭ^y:[k9Թ \̞Éb٩ܖe4VL[vńeSR \_y5 M}n$577-I FpL0.z# ʎ"3gU h ;gYrPN'1=d\R}NfeͶ8o+ H}Fo@f.E_χp*kb* \[#]蕶oc6"̱v%nNqK QĴO h[c)܁|.8Wڽ X$ZcsTgٖ{0'h7T;PxlxYOSgU-,&mZXX[U,R80K.ݑ}-/T,?_`Kc=3c VTq;9^LV\4w%{I%dMsd}-(Ψd93][ wx?3de%>oRvr0.3W >}$(͒*M )gӥ|aKB|ےrtXodɶ(H?37yPգ2[ Tv?:1+":IGӏR(yzV1}QY.r,64i’'}A+`dfuװk]A|Î߷#DV(@`J8rb zhAL۸"DMl%笙pxD ?X?_]j/.slK5W\HH?R y>?s?|ucb0_c {IKAm-0Z4^:-3}͕qDI!E:ִ}dqAX%Ɠ$ =s$kCj~gj:sfr)|,c! v]^W,޻=ފC*#T?E䚥uT҂{W#!VSS$' I>TjV &+4L @s h2_e4ި6Kp͍~e~*CWa,˧mrLVV]ﲨ_+5\b*Q;;S'6ds9%t|c]Yo0"9ޘE!M9z.6 )7B:)oNP58hX?Fϧ{5IOZa,ӝbAee8@3f}[+|0]Sk~_RF%dt][َM_sOQhA>Z*V^'}#??fv9Bϟ]j? ڎp<.Rϯ\{=&sOhIYNw`v5}zrh77T7Cw>-O 3?>͏o1ݝ=EJ?=,doz={Zx$Xz\xw`gWcfխ\SԾEϹi5k_ujn˛y*yn)tMNW߃8 9+z<%B>:?Ucc\YR@h91}L_7&Qe (x 6H |*p,3 &Da"k?:=|KCտ|e ~ KkQ>̶C94#!thІ.oLȽܸˎδ(mIiUΎt>/oBky#H9v<gz Tn?ޙYy/ K#Zy8,Tqy V~6#QMߺsv^/5i/R5O M '/'7:)Th'rZVc֋' <z\l=SS6z}nҫ^MWߩls~}{S5WLZMFWȷ5Q~3q6-mn Da%5%B'b|`?k .Jp'3_ldI/| dr+I0ŗRcӛ?m 3Qw&rg&o1x#׭lU{ay8^L+O#}X H.{txpOȼdepPr4 $}kBU?7a6"`vqmDriQb Tǣ~x*EVZnif C2ġMzڽᲊ-Uomi0p|Nw`OOAo;)a ѳ[/[^ϚJphia,;d Pkӊ iêCų>!MGWZT2 Dwm fY*):^|dr#a@".!3L戎gH|ش,]^ @tn0*_OF 4_W˅:aUkwF2sX0nͮ:ˋ_q'& ĺM M;ofrhV| +^ۈ)Mk3ͩzNu9Qըe6<\u*ڪÓR%y#X_޷UcJ!0?t;+Ӻ3ee)8ѿ~ؔ᫳ݾΓ})s[RNtuy{oABQ >׷7Zoi+^yՙ3vU/>n}^eOX/=قwF@4ϑ#} NE|w_ omow[zw|qh;fӯ_|4>^z gùϧ%>o;NOg;9]_@uWUCwٽJ銴-֍=k6:م1ͺs<<^(IU+K/;jԀёIhhUh m`4wTmB6ֆ4* zP .QA@( E%^7$/q3v|}}c+ Ma}0! >ݼiVu->z_LVNjף8=sՌ<RO,`[@ )*J$DTB^\ޟH=0/_z/}|7Y]NW|tg+mϽ3P6*PY.Σ>C{w w{iٜpl+j#VJaWb>fSӟZ{>Ϛ7x  ˉ*o_/{tE@fEJ)@x@ 7si4Ƕgwkvqwa.U5k]L M׸9kӸݬ3jhoaUջ*n97s}{z=h`Ϟ T׾@A)].v.Ճ]ݧN8 KgMk R>Zuq6m71ʘɯo{|׼Ϗ<8{֛s6O^vwn}륢p)Gw#NpugU!FvdBTPL1w<dh & && 04ɢaM 2  &A4hhɦИShѣ!4쀔@LLhi`& mh'dxMi6O4%Ob4&R&4&d S#➚d(4Bh@hF&LA3Fh&2iSѩbCM2hѤTțH)Ꟑbi')5'SFLyPBBd MSdGILbiMҟxzeOb)Lڞd&jzF`h($H4h 4  2 MaMѡ'FLMOLLLM)4bS{ ?{"O]pSXS:7l ̘?HO-޹E#~d_m'n<8WP8Ys !/e 0o,]q aL(el +5Q*0 Y],h9]qH,yd-01p[6e4"4R#c* :CuGP㠇x]^tRY:Cf ٰ:rBݸh8bQ46hS͠AT@O nڕ]g6wnZ:q$hz3"ӋlŘ0%Jc2)[q偪jdZAw%P 3zQT[ Ü3I% zeA1@dэOb+YFpXl LLˆ^oj/bkr SE%rW4ܗW7b_Eh4"-_;O=l~?c6c$Z;AA߫٫pF}0XQ`e/o6LH B)$<Ӆ"DbD%[UO1/bR,)8 IqghQlF 71G4IڣXP\KRjcnCץ,n<8ewGyʌk$CN bII ! ]<=&y<0 H9vh:TWzn ں2N ӽ g+L< i!lCAִzĠY3I`I $`9ùQjE+Ԑ}wQcM{-@Vi(Bgdovn 6{)lu=k:0;bq8erY(@fȧm$ۛbh7--Aa4zs+G 3AIA C1ykW'i?\MՀ#+<:K9P8bL}⛍+\E\KҠ$0v\ұ01gш<-*WF;i#iǵ"yY"<WU^G>/ BEX =IA]Fӿw^!BZcvtuGТ$FÓu4;Guj[A)%o<X k6x* B4xrHXrG_6xֺ&L(rGCjV#}ϭڃIpcgzv.  D1>2UHP[fiIrMy) w/{83. =LM1 @mK/M %=E e=zWV1*5dXrXBNoE'>)zC(,7~Bd{e"-e8ʀ9z5-h~ĹK]ڔH'DDtllk?Pq:%'BO3PDwk7egum\& X}Q@]z!R_CAMX%DU3H==]̕&/iε:'n\wu@جn۟4mb\Fx@=%!n`$.1N㶭^fhR jT[Os.gɣ>CEDd*iWOaڏHy]F4|8l*uqrsB}VGDoKo_~gς;Qd{8P͉޿D WdJgvz.S)d[ %n3ZOog{f%!lL a2 1d)#J9*, ,H:b'V-DNRY7ڕ.~R׮o0-O3mcyL[jW*3U  "HOZ lk _(̯jM F +h.'yZVmtU߃; J9.stcqڣ & ~guFsfasv}3blGk{e磓P/wV1 Ξa+XXŠ9P5nQ+8F[Un4KDXog*;!9q7p#>Tkiv'~itfK@ADD0Mjۃ;+|ʼ\w .'1;^N_'}FXO=50#(Badrr,86Ĉ.=zkj=Ze!ERDF`lZ6Q&EauDƋcjJs;9R?"uy٣R@(CD0bp"tsUlmc>1GER!iEhU[+Q.9 TYO;'![lj_~0Oz  E2A][3K|D@JL/1oͱjC2Svw+g5~zΗФA% 9&*Lvų+z]ڳ{Hʛ;LqzH^ț!_Ӛ|QUбO&٧n5h05GĪwR.184\!U~LLMhz*,8ҤYKĪS}* @G}c="kR!,SwRhtztg|ǭs>jsYoBW%օZ^<6 <RfK?| C#Hl `:4֕cS'D1+z}5`Y۪EA&۸ Ā,C9#7z.+ c|L}?׮.p%V닇$ Jnא4qewcR+F$#mD((uKni_M?c]-ZC4rLϜ{TDM*ՈJlrgXu-vݜvp={A*5O'@ *IH2BH=X9.;F*&B=oIZ^F_#f,>~SUi{xP? }72]sƩ'd巜eHϴQ =e0TYtJXBOTFb^@M|C, jYH D3pa?ZoEZ%3Nʔ dI~i l-9lΒQ}ZMp޽³8[9^/x^ɥ !4CH.>No'jr0 (:n1:H>͝ ZyrxEhZBB:]&&ne\^ϩ^ c8v'hoIN3#5v79YB'cp&@Dc0Hp|U?G$sJ0), mx|e_gO/p #氥l_q{VKݡ1 LW9mO>eh=ةؒli X,>>-y=aZq1ڻccH%/E$YV ڠ.B%&>'HIkm.qLʌ\؎2:.Rm#{ 9)'hIV+C qYb|6竊M~fIX>샻A 8qbvxZW "8 , l^"W~/6A,rlėt)_ødW,u8]P3 FeѰrS06V l|yv;FZ}''@{ 4.h,z.,@'6_^e-W]Ne~֣Ć0j"YEw==k)umw;"ݙ]3z2$>C%='sfugNj͹*JCz9.t"Jk[镲ذbPDw.q0$k8MRO3JŸ6N^*;k{ ltG_x]7waRF6TIRБ W$}ivsRՁWQO890Ob.rG\34QAhwi$߮hH6+oAh0*Sd w" -uoށ i_n瑶GD|, ![(as<_oӡ>4rop&tJrh0c N^7~JOJTe|V9`0cOFMY*!A/@PG%L!@U6wX( Y>fi.j fLU[yvsuM вD%"u.R(2Ѭ_ێѳ``1YSx9(L<\\ K +_*"@n:"P$fZo (j{lʦ,hgH \6*?o`6^7n`Ӟ! BfZJ N r9ыO=GZ%*Z)VϑtlhK6_9YZBbT MF9bz3s5dF9YJXoxeZkcpEK;ݑI8f%lYXxV('IBY3PD7$Q&O3꧴{N z\~vlwB;W;uuE]6D#oU+%#-'TE1rBѝKʫ1 W` v)-H)3WăePOB ΔPeOJh{B(rI]8S,GŷE&g6O8rbHO؟3bq4?o7y8^B# ¾m[2R, @)oh_QAPD#ٽϹWkXsRtybC[S/S#0se3,O'=*(ᛩ `z^*yO ]`>>br Ƅ.BQw myp~V\Ĺتu!{RyyF Z Ab !6!dp-y Nh] "c"&Žb gL.t@raBz i~ !U 0L!9`b 9`HVsgL/-bCE$! ll[؇N=\G!bB7T/Fl3h&+'l*=px:p7Kt=$. uN "Giud5*]mvKZ/ \%471{)166;;(f۩O8t\O rOk2ޞ^}\ %t-$uPt4 9?dg^Z! !o> >Y3NUG۸vT Qk~ 1zZ-i^^ޥFkyͩ=_Y6,Q<`gVXz g]NRKԙ<0+=6v`V>0L">Pp*aZH}:J]~[7/ESidcv:x,8*pMLq$3lб% P YYYѫ 2@c?=09 fMhl*m3j?i,Oal˼ u1ɜJҭԷUd.~oF&yPw'd~rg#ߠMo:29)@pعF0 ȓeD_[KƅHɞ橶(ž%p.#BdT0WnrXD?hgݐ!{5*f1po:YMh ^*VwmMwudA}eGsJMVbatZOz7PnP@SWeZy^"T Sȷ֥NZ2]o+Y![˪; Բrtv(}>glB *8ۓg[A6"08_ $Mv@c,N /ʈ=]PfP|Ԧp :\ݪ: Bߖړ dἽrbZvn1%4\w_7z'1xyNq~D1m.$TMdN𕧖Ͻf]@%5 ܬ?ÝpSM4F C}bԓPsNvk2Sqc{9V޼v8D!zK]Rd}[P7NMSÓ}9𹭥Z@8Ae[i.gj'&J1Hwk82P ='oо3{72@Z(Uju]]>M!}!6yZk-GbA;=%ŇB̏)"ܨ#%w2A .4]h#?ߙUv\Qx2Hsx #PE<ۻgHB6[J4ִr] ZVj[& Mc=C_0.ݶLlamcf9P;QCEY2 1.]T$o/J KX Jle.ʤev_l_Hƹ}\m~x.N nG@+9qkx=q۽dÍ7s+ɐHQLof6[V8a(n3JHԡ~+_*(RNy\ /;/Dh E2uUYK(Aoҝ $h/e"ti.5 1$@OH v…Ĕ_iqm_=ӓ?5|b9X{[鰣ʳ;1#IR._P2sbk&l! NW,[U`X )Eoq^ ڷ`.<ʰT%Vdx o)<Ь![72chWG-0!BLoq.`v#Fx#$ y!20q#nW4I(}] 4!9 |ĝw;7[xpXKN?;HT9ltX 2F`@Js{]!2$'NU'3iA^yVyѴ27xp<ِWAgG(hEȽRwS!c2O}*o^m v:1xT@LlmyVoFڗ^uMqs,޴{ZDȿ[;{Z-JÉzҷ.xFϣM* Mު@%־al?&*zX1HUJ'I_iaGW10D]JW6x::b)&pDYR2f0 B!( Lo\4 լ^2מ.w lpkZ2I44dae "Jʵ3V\lo \\XL-D>+& M='>fR5)46^0q-ڼ*V!e֐_(),֔u$kJJNv|kufw&=B5z˹ IYf2adS?fjGBh~g@=|=W)&*שҷ;mPcȊNȊXY _)HxSXUk ȓfMj#(.оY K&$@Qvr6aVQXe".**zNoaӀ-'&UDU=A,t͝{pM]v˲ v|dH\(=x:zlpGrEMɘ$<р~Jv; #G!8w3@n.Ȅxr[z`jT#ף Q?TɊMS>WPŔ^2abZFZgo>&u.C3kXBAMa0m:F&q[cLm {B2%Lywsu,Rյ]@I=i7w* W靻~l"g(JP(U*tKԪ :da<DjcKsKYUADdLU'Si}[e*".{SP5JлTZzKwU̗$iB=揗0{\iZ'apcM:FEZMn\qJ jj3(xt۳?O:5pKGw+c `R,0ãڷL)IAU3wrYۋ&s^Ah"!(s %=&!QXv+ ikDt51R36P @0^x uhpxձ6eu8ՍErQATXMvLuV~Br .a]5DA[?ؗ:O7K/%BüѼp߿a0(dn%`B%Ok\x@/ FL6#NeC[Fj o$-V !0RP]Ƴ~&:3F'&K -' SgIMS\q AyW'Yg`ed[(ֻ6qqc[i@5>}>ɾA Sѹz/C~(pe ݗvv RA;7( @FYwѡ{Imioǻhsዦ"s `lo>C(@5xmXMgQ*Pa l~GrrmĆCiCme Q ʖ^ZKo{zFWOi$ g']3 oenqٟe{} ġl!Z}4-g:. 0HQ9SQ`zI,ktD7hS/QOTmk$}ϽO"t2OZKaQ_-<.X/+`Ρ]|nٷ]̢Y^UEK~-8(sHlm6@'#P"D+*Yk!uU1a3Qy(O72qByRFq,yދ]M}mh#/Eٿ0&A{!= j+L[BQߺS=dT(a-~c_ƣo@߾r vw(76N]x)o[ԊRIbT oLl&ȚpD?5 #>!<@"!j;ZmÚ$*C]8]:mC ( Aa?E0S [IK|޸^ӪJ%?Y^.Ԗ>;ھϘޗ^i9?f2Jku?wzbR ͔qRK<$yo^R? 2V2wt9V<18!Bfhgk󰧈gb!dMZPcu+@C'e \~҉a6̣? p^]҉YM!YMB^$kBU<"4v0Î, "$ѣ$F{E(>Wفc#-Ԭ 9h]HHя D vz,(9 8]ʭv|ڵd/ FqѲJlli扴ص-JJ)GnFm5oqh\c [I;9ΛyA}C"MmccbyסבH_xo',H1r1a7c;WTAuU.?BsoþeXvq5z%U՗ uiu׾dv$XmR'jP?A0vFH /rXCfvw.|f^zu_˽sc}A[N*f#Ѫsq)՛ϫZFH_0ڔX%RN uciuĺ ogcmhnqDG;U./UOr{7N{WQqtZײ:h 6U;»Mo~O=]cYQY)A;|:i*ՙMo}m59"\ V@'qѷ>㠔}Q]]4[4նH EJ*5斸/rl/%ڑH^HB#FH&"kv[`Oyq˹G ֚6`1/̐<%t$a.RLJ掌f`t5IƦ~F؛) Ӹj$}&Nޘږ<>OSt/t WXI' 810H܀;_* g/kMPZko hm0by*'O&Hw<\bBa =ƛ)-@(&J"o}[׬,϶+?`AsCЅ{s"f)#}!d PhB_Ƿ=-C^T0ڦhB0cp^ @iE 8Jפ OdS.?C`ЁsDU\=pS㖵]N!l͟enSeūFcĠR3s|S6U\oֺc tӓ^8yc$'_m+Gm0""ſ 0QPU;P;a? 8a+-!$&@A~GnH5JY}7 vH:Ev/iM/y>/Ul,IAR8H@`J4: :MrUt >/W .0uҢUiv?znQǝ? y pMcmEPza$niHyZXѴHT@~Ǟyx0fe"ɃbqnqgXTJ(CGoڟ%d I(Hуʹ"D^<-H,+PR]GcwRcٽ`1`XW4p^sE),uo"N:pWn8s}*u[+Eܝk4?jF>(gW;?ʽzOMcUKĽdMVtTg9Ly ~>r Yk߇Oh>m;1ɇlZF|\;G.C!GY͵Q36Hab85O8 ڐdlϴPHn泈d7DR8ok# YWo秷)Faw  n(8Ɠ-:Q9/6㫋H9kP;!YkBw4DmRfsp7襣:! { $âK0)+;,e{\!R-'i.ӊ$ g?٦ 8=u&(kT\1sye rZ>ڎ!_h6tq處tQ3}NkyVhr^?]yfc[7/{b jZ!0/v 7 П0MH?UJSI4muen/{s ccikt ˘ٟGfg%=u4r$ױv3ftUIMIy.)iaWUZ&Q/wI3RoimUH|+oJ3C4G e݄F:Wu_PlLقYcVXϏv}r6,.^W~z_oL5ݟqy],_փ6ffkHre @ R{گ*$X}`U Z6KJ 4*LqhLhM-{T2IZٕ lA,DMr^<1 ]qjCfl+̆㗚RnK}#)٨%k"tڸh<մ쪹Ǹٜh A4B'.FZ"%JcdƎx1j0aWDu/1@e2mIۜ1.M"A+PA%\ݒmrEϭP%M*Lk5y1mzA/Xzh[H3v䲩n ZQ:+y LEP.ZMCSI R5ZM9g%F-@vq1Bos1:#q)ɪƧo,Nx1OЛ{^\o@=B.ߧ/$*U 8]Bǔ7ȁՇƍةi[i;Q5j,f#`Ō_b=]҂ğNѩnHՆYSlg8%kVjGQBg(d^8ɢK"xʴ7w5)8c7;RHJ:<%e\'sv2r5 z~L>ﶞz o3KmxvLt }hB4^@HG룹teHǹ=]E]~*)-g]&i =tQK{1-?]0tŪxbm;}<*dp{$b!!} QyځV-q柂;/8'pH8IKshj'r mOcWm|tb-ͳqp>G4r$l$EXSX5x}|Gj>.!̽W,X KckfyBY& kdXՏ.Dwe @jKOs$ H%NibyQY w9 0՟a h7=qHEͤ(2#6~_rYёH=1 ? 5dIj>|n"I3:p8 :b- TiYjZ CCQ Cm33zL[J`u!ʇx9~SR_CP/6\"!s-I!un1: +[ZH}1i1nZ,xz/%%<NNd2sqqݥ8$Rì) Zή9&wt" @2YZ41.&q mRm-61YZe2_z%`&5Huf%n *q }]Kp>ѱ [`oX~m?_Ogʵ#5BxjKxCiou}\P]KLԆ gVRd}d;JP0EWU'=VldPcKVk%HD*#cm΂Z΁Ζ=%&_ ldCK}{}ɮ2 6L&8 033ۚ!bf$2,ء09d`S#(d,Lq*Ȧ] bpYO,S@O]B_TEMF?%} bxVހC(R,|Q2ȸNAif=1m&CvSX{mշjtؘC>MmV +U49tC"sJf*Dd dqб3}ċl88qJ0aIJ!1srtnSkWxTrE-c]PrLgqj&ᦀ#6h'znO?ϡa^l>MdiE z<Ty)H/ߤEMom@RЀ1!T>rF.m^ۂY7*gY3)Ɉ!5Pq3 cү)4ٽQ= [+k,oY{BV ʁ0uIWϭ(mۀtsy Qwj6-YF1mB/a35K -2~C$Œ':g#R\:&54= o6P.+dL=~ᖭ5Ħa7ξmj4&3Mq5!z5N⑤!Mbف")Z t POl&cTd~jyt7}=W@KjA;J#]' pl#J-g_RO 5`kYn0u:-?ijظG{c2Ylܞɶ0c7\((xrsfO1ghip6H&/`a&#g6Q 3$ E;5 s<*~#)n(X\r%"aS&fh=LigIˁ ojqQCNz,P%b阮<`Y *Ӛ6nx1AKYNvm3}TIp:oC3LZ# yzҊB s9;G7b4pobN p-ILra9p09!Z =零tLt;!{z>a؝N߀5JyXw%>,F(zS%l[wo_w"èfgT,a'3#/߀NrH6Tݑ0l쌫qFbt/dD &JƲp';yAxW`k}V/A' lq7[^B$q{A`gG2^ÏQ'8mV R 0H v*R.؛z0=k*Gۛ1(yHPt u"AGXlWi-GLU " Ï7#,o kryn&1շ)T}T'}lx *. 1bŵb!$FaSiۖz6m|qfM=Xv=@P(u`9hIZW<6|?H7;b#AuwZt;jVyLpoġoLA_m9ViuLHK^؉e7f/Yx%aY{E.[h, @݅Fދ'y+D9vPp9T:*2X(xuLʝF -)y,5!06Ҕ 0$M lﲃQ['/= i^."9ۗIA^eBTA+XZ 쟑) lPr)|Yj@D{/8] Lg!97"QCok8!?SBUfk8fJ`DLe}F!seLt[٥yµ|ΐYFTAw(u upSfר2-6뻢L)_PR]YKVbO3XmCD404{^ApQ!g1r!*%+#*'#k*j{ު!6wZ$*\;"woք? Tq5 4G86Òb#8ZdM} WYPgIxoe<%e& HjMӥt+6ǒFcXQ0mWQ}Eo=U0Ѱ*[AuBhZ!1:}@{G󮷲,/OUӡ~<}vd^+>JP%BXp^oRZ^ 4ct݀3륧4<GpoJBeR'4DPܹd7KHlE<̟W4Lp3hu&{j~=xP̰>Ay͒)g*(bo7rRZ59=Qj6-PCo Q9["٫T(:O}dr3mrM߻GM_"HRes.h*\umwkē贍*ΏwNh52OKF\`nn*-cy>w|x&ƚmZK& $$-#mddg 0V@M+(l`qkO ָy0i9cW3H:ͫE4-#! FCcb 詓! `цNFL 4 %w eU3Ms{8!ۡNNs"zBv=9'VK~9 瓺k."P.k-+9P4/n֠j>/F;k="86IqAq;dJfR\zn?UVIÙ&[,œ:ըs}w;'rV7FtHc$sB>Zī:RG]bNB5)WҎ[~Y4^ق@iW00TeMU3 I1` k:"qdD{8 [$!`;`WR{y(P{ ć#BjT&<_h 'W^kU)jFZ >4+n2q٘vXX# ?pX\G(MVO1Map0Dm\iVvp#gzTBnmea5u &eRuiB D1Oꐢ"sB9E`+I7&",ݍ~"]E <@jF^Ϣ` ๧O+X޶e.)nZbwPA+ϓ-t&I~(-0F[I8W}sė-S3'qQxWJS֏wÕ՘@C@:@P'BҀ:PQ@QBd l͆͹W_EK>I#<"V\]LlrRx1Zvj(cJm~1iK@@wƮ`>Y}zA$jՀV#wohBrv`#W&>D@%0Cuҁ/t$f+*&-s 9XR39I+w>S +%Ha:RFmz)z 7nORYii$&u62  BϘ  OT0Bş冇0C!'9Ӹp'r Gna88Z8pQW2Z3\+)әNa_9!XiZ N|5uh*ksR|@Z+Br#9C+67 Gk2 4J얡s s:W4/^]n|c.fq+sI PipY滓ND"%M1ɿzlwD?6z5S#m641]pwX r19i80'5úAy $}1ѮR<;9aO2j e8Lp@Cts9eLq/'.8(!9G+W-"C&lc&3GqwMGHjWrʆr0h th-ir:NBˍbJr^ L+#28Jleo>E 'I~bD|idփU3˺X1X' .~XܵtbB=jϋSa>#n`riTVbw(&H.(389U;-a#Mp#a 7 f9@ ~&5x'3N9LiG(hlɧG,k(6 F\Dv7/# Wl"J3yR{4I#(,axbӬܭXaT3QHG`O\5h9Y5.JWG1bZQŕniѢb1ڻBhl琧Ĉ-~J9ަO>~X~=BbJ=,_n%mra5X|.4pʪdWx,p@Pύ%fNo@}MbH+HQ~60!;܃2 1 lAnQvkjKiוѶLF =XP0l {e+nkϹvr={ork[1[]F=mR5ӆfSCsX]̾=\ÔuQ2d+^CœljV7v="_pӮ$Hax׸ZQH @9D#Gb'UtocC1vDYk[X* :dLflz4:2=`FJKl0Ye`;=ju򵔝.wLB\)[RӦ+a{ĸqȉ.,hq2ܙE:7 5od9bTkoL~Hʆm>b^OTTًb=n]үT5XJ/]9W Y"*5[v/I*l*rIvQzEDʹr)ֻMY@ȦME煲沱OM[VEUӾUK"7066E&IRvz wl@uFAyv\>k~% +)n!IvۋН8x#/dF75Kv:pu?-5b5JKzr`3I3)VBI$!CM(m"}|CїBo=Ot| Ї'q7piV[xausEG96vT,A2Kz+O5)su7Y9 Og6So<*նix_^_`-Zs%wC+~nŀ39NM1%XIROb\$m i;`!F^ 4cGt dQp  !`)6{V N(4s1{ ||a Plh"Xք1D$@EClw4ƖRU7Ъ&Ӡ-6[w,dtM:Ygv鞔ZF^=SN@J$|{T3J gTt̻ {kp<yg8ڦc=ztH eܽ1'ME]9PgrŖ"9kfsn2UAC 6R0q=7Ywͣ*H=sڪ5_i@87f gY͎Q35=nwhO*E%^Oĕiͽ0kOY/4mqP?bz{r~NRbS,\(?b_%=2h!:sl:<x*e2 ,g`+aAWj o_胁\XQ99Mhe57\Wouc\)}*\'9OW«5U 9Fe⊪0D`?nc@˧ldȈ?]SX+z𙤵Hw[ ~ Gü?zyDr H$WbIuo01q?%}o'E|pR~iUKYe/88&n{5t/ם}>=6 /;H.xpgrfY7vhl&9Q8/UaH0脆;6ӼD5NLP|!@ SMl W/7NعʡoRzsj\.QK0 jsc2$d7 +BD}3 rly](W6Lv zQFsG]eG΃ʩRXPlcԏe6n1D$x;P<'aʴT/l-\="Y’$J h!vrZ(j LJG Gkwo6]Zs=Ts7xT;;] s08ڥVǂl@!8d1HguA1˸|kZ6q2YpxZX`Sbg_5M8 ~c}agI6CJڌ"_u;LZT,k&ʡ8jr(D3`lMÍlL4η׺YĂ6+l=.6kXaB{{۠ȠHl(b4Zmΐj@(ͅ9%Q3jT{i:l C&{.$fsrHd6r'.#%Ԧa:y9E$]_Ö;|BTpdR]'2JhNUpWϮ:f64"4LZ<9ѿw=qC;NG뺛Rp낦ۑ?FSn"{85ڙ1ɡRID~n=w;[赱%j=NCYS "NIHyAtTp*uV%@7L U~A )B.IF_1#` yúW#k2Jr/5ƛm4ޞuw j4{^m3gGP@!DA諕l =aQ3y"Rƌk|A?nF9D>0ZU\Φ:½m#` cCcyLL ~S;oDzpHJ611Y$pj_ʓ.+CLC͢rG+~P k7:g2 ɠ S{dUF9LDED񴁔(ZNw6M\ḱ%Cƃ҉`Z  d#n@ Ex "Х/11z"[dq6gt} ͜ĂlDoJ.3USEǸ8ňU<%ly7b򣽎L$c̆i;V~5XkWH\iI\#d5Sq'S6t譍\]Y{vȒk*0 bb||V*UC5pMz ^nMY.n6b3r_j3D76v@yzhrA't}@MK'@C]{pn͎/+búnA"USJaC bwgKS rm "͌Vsf%{;Np r uK̞F߰lx)3#fP}p)뜅 r{#m|wzpQ!b(y<bIcB<ȴ@#1Y7\X\FHʌyYihR34z mœ⪷Rه_[FRƘB~)v m#Z|۴8([0l8`ٍMAÂ72> } !¤>C?)>ԁSaDu""ˇѕ%_ᜟ;趕U}>^!4M~yI6:sppli?PC1| ?*)ΑP(G Jv]\?}W/ʽ6;*S@*v UwyƔP@%͏Gw\ҩ΅!:0+ӀCϵ_;@ Bi%~BkܞmWJ͇!sI9T:~^qi9H5@8tAD`(mu`QD f`<]( G G:0[%nye Bb03|mHK3bQ%Jኂ'gSn~u3IT(O*j=<N׭y٘++Ā?ĊFѪ^LOBFOރ! BB؍$r``4I[$J+BH0QJkE=/ptkJ =+nت,/Iz 64]T,@`+I 7,P`ihIis!I콖ed{/ YA  :q{P,ZTwYi /322ˢ,p!ǟ;оWXg[^`\XA?4E5\cb*-ىGbְDe 64^.j`Dچ$bHy(ץq7u8!ܰn&;,pq3TЛIhE aŒ2AS 6P/YZD"mR:dȳ\hcnPx?nVI[bB*b5eos!#{_x ,Ĉr'n:;~N)EAGX9 ԩ "gu X*IЕh^|/K cIpK`1HzFb0 &Z31&(q|t)U(> ܅DoA;0"/u47k}>]o(7xwl;iŠ|QUTSQhv;_Mgz\Gu`{< #@PO.@W~mٟƾ=hCCZWqh42~T:;Yi]⥳gG{f\?wDBx]y6FrٗkXwЪ^笫vj4D 1IC`؀bͻl.G˔LR>fg;J)v֨t!|E46a 6ߙfby1%DDSTDTE 1#-0$2+lX@xw=ct),Ž6!;v d\ۘhc,plPH~ [ғ{_Wnbh J R@ڈ13di1yr2d2P}m>woѵpw47ڨaT 01 HfE(k839Ā`I-`Og$f {4LA]/@($gQf*]l}OTێdz0|r_B\'2}?F+dFDEL8fe20Ȃ%b,##\C't\M4E BywOF% xYp- Ӊjtf5dyQ~LE1TDf)f2}45)KQ2TI,L-4LQSMT10`*(o};,("*#|o&Owufh0^) $Ba( ׅG[ɰ6- E)XgCǚ Cssn2ok;5[mtW15D mt/ `h۹.q1H WH~Zvz+LEqhbIV/5vըAN>wɪULKAG;>wkw Z3YE/ LkfQEP8g(hY&kr[ 7cIָ rLժy [sm'5ח8w/;b*#)}$^ bsmeSnԾD%?4$]sh;z&;{;uTy%?̈́+ l<.[5!ާ,袀y>3Ch&!#|~ΏUT18W5(.%ցK0G0:n/oC _泭)BiD{*m?3 .U3-I-skck[s7u Y-6֙|3 ?Q:Kqy|nhیx+ݞKCٙ$ !t:F>N(B7mP@C@R#K|QZR՝=h[ y"'Oyc;J kgi9Պ*"(h "**Oo0>z?.;_irH6G'I]:@54u-7($JJ#9IסBP:8.fr.j2 `!*ʢrr å;*@BãW?<.~E5ER45Ɛ{#Dt 8QE:$l;734#3.Fm॑"/,4VPMkm8 u-h(+mwE4&T>47Z~7NTPJ^~MÁBxPwGœK{ٍ.p7ĕ E =(zx많kwL=9j("hݎCEAC<§.&إKH Ha”#X vPZuxi`,%s6XWc0RVouxB0> 3N*Kx`-GUM%DAp\?CG -ۦy,S3u :a_T4ByrEy/W:///Y|'&2VS/H jbh**h"J* )/('r9G if9Z*jJ*z{Nz'>KDBP>˺"Ǚv鋁U<T2YclTP<T%!sfmt{J9];0ITH$3b2)~4~aTQ,z`0 s6JH+K \r1YNa`6LH SIoh-garTQc] :0E1%^|0PQZ^Q#"vs DPLDMMLEUDDR r61S`?k1/V >9D2Q;q!"J %&$(i) b)) ) ii%)*@*((J* JIphɾ&xiibըkΒ8Ӻ`g46t'%TCp!2;0NUN!>^yvh( ËA~#|111q蜱")̣ e#HD|oA] ˻f-TB᧥AxN5IcqvJbxOl"cJqH!HP&zzSLg#ȔSTPPWSmGH;:l 3A,YH@ 陆ᄣutV$x<5yx PS[3[)0H"A;e(IGB@[:k) B&R"D(&JJhj("%TQ1G;xh; ù3F٭zT#[d35zkyZfXib1MPQTW;ʀ>_yoiwul:ۿu^5I+ADUSDszSTSz㴅Pv8y/:lu X>=IK>*/A(`2dn,aC444fEޗhOe.H2)eGLnm.)$I,8ZzFJw:oD+XWfx1CU1MTMIwjM'/k1_%W;i/BX)=X{x<o'cf"♊(>>vh]yIAAu& 3 9~ ngT094y0A/bbG%dgh8iP_ukqqaXP(4DM! DfPwMWOJv 8Epgz}7~2_<7Ҁ̔W/ lCL4Ytהg7;f|C>$ չ1]XSɌhG8iv->GzٹޜTPDW~gU@fㅼ ȋHCN0ܧkSŞ!{G1%4TPW\?U?;yД[Ӓ=n+`O%O1Žo2Et@#i U^Q 1>=️WX\^Ϗuĺy3pxk%KZbCy}G " bA~.?szA&;CI}Mfap1_a/N1-4Ý򹜆{ᯥe^eMD1EPv?4)j|a7B;[5.\9 ypLU4U$O\Pq^=)ShXlQ]Ъ|_@C(ËZDx& "((P?A=t,AC@v|I F[HHp0s *;Cּ—xt5Řb$ c MRL"PHDl:rEC*zx4vuāO9:$Prʠ}")( =N~*Y)⦂"]@@(^T^.8ACHx< =HFEЊz2"}`I(("? =96W|w O@bjd0krK/nQAuYكNIʧ'4)J: qڕ@dDOʩ! |vt>P˷]VE !>oGi|y=9^ {(\T~$BzҩِCRBi uÞ* B^&ZB"!1{1܊!5>ՔmȂjiP1 >%ρE,WD~ ?uOa ΐeD(ԏZ|^>m%^"$V`Xwl1%;0G'`{k\'>@:Plx>oy$E:AMCUtԵ@JHJ ppC)HE2UCp)sH0$1À8S"I)lA>G"_^a݀H]x 䫨T  Ār3hˀ_ ԂلSN\ ?ŏo(S* ?Ѐ-% Tܕ|H9`!t'x)W`QXGC 'b_.CM'}]" q U>@΅~B.Xqc#{K~xnO1 ns|sNO=b )">㭏>G וdKJ>%{`ۄLH@UBjw> $JPPCI@R34H!2 @ 1 P!J44- K14%)UTA}9r;*r룽 4Յ_Un?uGYc:c|_/ d;p,?&f=x$WkSsRRKѻ VYzl:պ*ۜB&L/36n"![# 5~$\?EB>IYkB-"M _ O_&OcI"$n!Nf~ֿ|Z&;9꒐ Qm%6L \>)Oa{5oq;hHAZUCztK9YAB_/ ׅ`R QڔPDQ-PWKذzgبGPiwʔ'ʝԿ7G!!2Ġ$][~ 7R3%3P'a^dӍXNީ@lT~H!Q=|#KvZp67ܜR#%tciMUH$8B+wc3[U1?my s#Cl3WSxN"'4m:vQ]iPb9AhsaBK R˴A' UE|O6SlƂ0io緮%BW !|'HERS0=mX1@70~8Ɨġ`ҏ{^G_n)~ӌ/&;x倡oeBd3y >Ao mkԷO}~܇!@<(>}KfvmzWE Pٗ @^乼.ݕaa,l_EWOlfm'^[ TQ41D Ŋ.K*3J,{wų{U%nǠB #x`$, Ta3X>^AJa#{VR) DS D QSAL%!E5IIE"g mBI%n2w=J\`d4-bBs3m.uc˧)у^ڲ꾏X- đ~[.j{-U#־P Ƃ dllw͵?MIЎ7tfBR>]T6bwÓdX(WN?lal)94;4PPѹF QCqM={sB6rUD9gIn,C/\S .Ъ&aɚ$>Ȟ=4=N"n'#~l83Pg^o[.#2c%!b?Ko[Σ&?kɕ\:nj+[:vbd'?DyTJ;ȵi=}!7+0u{[5Z&c~wRRvmYkT'd"@h}M:8?C731=,nRP"I&IBTP)!AI%.TNDoz06w5{Wi]ND,0~!+–Ax b9ϕnB ((F`D""H9fFpvB֙<UH?8 FA(칎{xAv] 43hxWHM92s 5ANaԇ-3{$|qc&uiv]G6ώ iguJ}KS\nICN9UAx%@>`7˸f hiimyf=Bkgx^r2 )*Lmۡu SG6("APMwq;\mef4. CQ "xce{./8l{ߙbm,UBU]\"\y08 ]AX#4dĤfB0!t9N\% :ѫmkX]>qBT!J8TR= € C!s0ʊ E) AY)ȲC*PJB B"7su,"\gMwez啺›RO5ȸY. Lm( MXAY_{~ʳ5HctX\.65_2$! 'N!}NKDI_岵Xdc KJTk!e{x#x7`zHٔGN`]{ͳ`9:@k`F?`_ȴaؠE? ũH9)Wh沰pP9oFS()ˎP'?]u4b4b^MT݆^ۮ1Dq6^I 2]1E2ղ^57\4m ]ʆYbIΞmg%jmikFn$b)#]k}ߜ=Q==.g@²@HR) tvr+_l5G~kra'O9f57neu,/j灃i`UUS2<%BR&-z J|l bhAr~ i.cІn  "yP ]0z w3M Rsjm@:/ .Ujyh bg.nEq = C&COm2K7< V }Tg=ޭ0)`LL("I)B*,U+Xl!U WUp5՝FD512ij2pƐ-`eDTAq+!@{\KZ?XX'İr;,϶8fE=w&X $+,;cVoFݓ4b>ܖz\~6\J}a tODD,)Ԫk#M:f-U`P' }gʡtSnIpUVѤb7Bz31O1(D.|xRϴ{Yn8$o_8C̡񎱁 쩒 4aC@߯VʕGbӑ&9 f=Җs_rPwMt]Ώ?Z9X?OK&&YfW?]J{bބY LfiM ƵYCMY'LQNsyW҃w%0fa `0r%Rd mjp08TRi_)S| ۯoNci3IZ vz5іY&S0YT gZpZ]h\m)r)[ N-vuv߈ j^jVʡj2_>~Cq:/zZscn3$ϯ̿:QˀpC| =l/b|Al)M 3Q]Ƅؒm"[,!,?m#44EblR'x8p7~|U%]/#'wV}1my%}IT#T`+ȺgSXڷ:@ !e.5z#ܶ`\;t xʅ$h]|iO/D? P1MDQDf^F\ 6Ċ*v?V2]\];gl92JSE qbG|m1~}ߤ1- sj`[vN+Se H뗓ޫsH/Q$N\|i8! ok[-Ӱ5V ,|q4Q|b$!iM!v/v~Bz0hx UԢ| ~- N<>Ei ZZ T(D>GC`v9Ѓ>(D^?q4Wd=❈| '(_!?OP ~"U>O$xG'>C 9?CȄT"p~=??Y(Α·zR ПG':@_B  D_.~,@ yp2#琉B1(hI/=/N) 1bAt{W## 0b"qi"}ΗW hZ_]9`"d'rć ?a#`%PB| S$s)O"QE䌨0}沭/?m7@8>F ˵9*}>/zQd|4El9o7ۍEzV} -´SI*0,F_8`z^ _ڔ/ݣ*"oQ [8|2jO.7J{>Wkv]]\K1>'irpt$ngOoJR~Ow|os9[ִg=/{o_ (Owz~ +}QQa<㪥%5D Zq(z-h+R;-"\Q::4cBD؈u9vkk#L Kz}ftӲol#vQ$u͆:⎜!͐dmT:R2D?g UŸ]_kƐ;h"=R:K&)vL b %FڝK<`9RS~ ((m>BeI*oR=ٯ7'<49N)3>nUU~0,;g_춲?9D8b6by*,~W$Ɋ@7&h2\j|riUUtr:9!Ĝ|Ɯ@u2F`\Bx>(+r,(Y8dngŸ{%U/D+}H~>.McR%ʾ@ΉQH8q"E`3ѱr䨷r|GtJ}=u3ڊ-UUrd#NKG`7W̸Cznɫk9/5̷\׻(&6ӡZ<Fsex^;"鉍kF h 1)-3b@ץ@@:@}y1|H^&h?O Bd|}UEH _yziG8{$T>,2؟B'ĺye8~sHd}d'J_$ Gq'< zi"+>SR TGcȠ$H~UЃ@hB >Wd-͒'^_Ԙr !؁G6eR9/T/m=']:ՕTȭߟW-Ug#eݓ{~#Ҟ9rSK@VSn[NL1|Hi ɤ2nPHaD ccmTr!|Sy/`fqyk>fN"^O_`g\Qq* .Atd'BCM `$ yrM7^uoK&";^?RP}1 i^mP{Wz~".AąGBa],h^|aߚA8~57"LZB@9z-^0toF 0K Xqp59=Yt?-d|=(;_Zv]dz$Wl}nI-V#,;TɇvQpJyIOCuY<}+\~3 {~@38ޢ7L+H`!zS7=KOA sCּO_!T;J ΁rz0!6U>N@1j-3~ 6 #/6pCctxrŀ>P!~B{ï(~Lh?ݘR!E%QJRYG@ ƙ|^GXWEDmTSIӐ((/S2he"r(G̏i/ 侢G'KzPL_eRmrM0u@>?Qa$e2sBqȓ"&7Zeɯ:/i|LfI]N?jscCVDk!{A(ī-Tf?ɕ-ݒT_| 6m-:RRm{z]Iya&[ofsbFg5)/O:Cfh3K'>;<^3lg&0qy׺1 diy$b<+~1'#ElxeE _ e}j Hݾhqܸ%K kG@[u XC8 b!5O"N=E.,SC, &9lVϰ;) h߾Zm! v ~Buϡ\Ӏ'(ƃ9 fZnN#ʌwd$B#A/zP;b-g^AMWbOv{/?짱޿mo+ T_FLI0(ALJCB=Cʞz7܍_Y&ɘdv/HK)u t./&/ A J]n+I|j_>:20Z L!M]w $\}}^QY G/mo Ppr,|ܬo~]<ÒAhFk-a7@<~~f!FĦBSzI-~KU$d CB>"'!R*}t!2(iDP_ȇ @P)TupAhO$_5BH9gΫ~ӹfn}B4R1#]C"lR%Ͼ?b |MWj~[6d"-Aq٘3>|hU J ~F9 4#QƢ' ,PVuwEnI._[:296ZfBB K^p|ۂv\<7O͉ T֢C"q}vqy+|_W!(ЇSC2;O`жd?ݯ86G;{Xfm}Oࠆ?O g".C6/G=7"Su?ZQa5YA >)JP3e W<`@MzDh_:E G9 Py&a%7 %:͜N9<9]0[O<{l2J ,]e+⹪zo'+>o* $ ivp%pE `x]i8?Nާ`M%!EYsl24nd>YMjJbF]^=e"W7)lV\blADSQt *2٘ղ^k~)o&=0t+tG৸jjh;vjWⶣW6 Ijf?>'Np@. aPzgc=7~}?R !C#w%l.Q7%^g[9}ܵ*^,$a? ͡K%A7rl]Κ1TRG8~V3EѾIGn=D4)%1TaI*@:)*6&/"#0!i%Bи&udV$ HS&b=7E"-6w]( c. 0釛8c}=3ib_菌/J/x(:},s(Ҕ< '`( ]Q)S7_Vs + :^ F6SﭠRCʁTNyp+"F;d8C=0# N'8NF+z]zކ#ȩfLEUwzp']6Z0%-":FLma&.89 " (!ٙ5 U%QBELQ|uUmE&hy3tm0mӭT hrjXw4hwXEI:٪NPMǀefY Ѧ'"ȤiqmFPֲc~AlDU;akZ"/_m~GDZn(!:aDm01=n5;E2CvmAv$vƷ1d&Edc&2y+)bjt%|R[A$ӑuCc8A^RBESQx(xҩrFrE4n򀪥[+TVJ&Jj0%%:T O1+uז$!knEWJ|n GB"pbc C96 {Mwb}rk!%=\ `oR6{޻0M8e}+#ӌT1ׄS2`mQF Sͤ'zZx]unϴyL|Bǡ:BMlw-5DZ6Nu~|mn}4HDť#PJ;7kR\v Ĺ-OW /B68 `" 1 }/,PdݜM{8SdtY "İD- `#.q,"sE^?9%G"\2DT 석h4%!0L4k54ʑ. , p!û-,IfSy;HZ6~Hb~8hۖCA: 1B!ՕE tL'`ϓI7T@jAkAmP3WTO7Eȉ[W:`%gCr]۴gaRCâ8$ 3j" lZ~퉽d,U];5ɜq3 B2"H+x >LaB!5B"BIe9??LzZΖLSoo[Em=+OTvֿ؟;7|`i|zJzεuh; z-)A)! qfP4WW:FFj7ba UUQhE+BEJ9+a.W7о3G}BBj,vvV eĖy}/= ᓬ2R,ʥ)'TwefI]gH4wuk;1#1k; 8CoѪc +H!E^r*+ 59Wa?TaR,s1-vkNoYa =t!m]g#XWΑ.I"3aa|Ow0xB,Ię8I&I GM>oqm5Ŏ &. R. aw.ۏ~fƳ4jJ9m " Lr `&JjH` 9)2fp65<.kQY QA6(Z3 Mh`V(4f*8%HB,z&TI+:!!ܰAw.A0YPRmФkZS<&Md!AKdAT;5Y99 KfU~X !`XRKII`%J,HDT 9&$ K DMm]=6iʎ)ʂ2n/F[u~6l5m9Pe;@ddXVp+z(C i*o&ټ7`pt*hZAo/i uMI`!KCqMa y)@j""ebY7AEHnQHn۽5K~N8@t-N\$5!J, ŽQ վ\ ~Co ftZ22YmoI"dKKCZW b@Pgjk!fg5pɍوFS96f6ktZTn[[[fRbsQalhFT3mktK.=hb\.T+V6m6ۍ"R4pHaAa$AIh̭O$m˜#RZfl 2MY"FjͭkSʇfͰJqd΍DřZ; 0M8o_0 %HD 7{?bbt ؊]$,H#v(fPQGh3qo֭B[kq6)UluXeK ߂k3 pӻcv`aUmH$H*0$0${gAŘ0.YB6'fowRm!7kܙnݰ O;ncDQZo2`j f'cZZ2ؑ)@P&H!Ccn݉mѴ:'Vmlc⪔A  (T;&a2"$ QQ΍ 7bվ M Ѵj]Cu)4a6 dz1I:QHS쌞Ӎ;y=O yPJ[NKH H{N `]Q;3AӀj$qBRblp 0^^e3t uL^(جݔr/[H[qů0s;,yM^q۶ZCEUϳЅ,Vi>"#M羇o@)WU?@pW]-!BI`1)s0\ $~6-U?sC$mCAvʭnM[k>r43ӌ< -N΅ b>%jydUvV0'F@qM;kI: ~J/Y6йdr'.a]#\jZb6]i&3 e4xiH D(@h(%~jXDд,P k=U v\W33κ[^}4N?$u-S)3i$>l~G`}^()U(@W`k`{KNB4%_!.hNWkK_efdj nε5ha(w9j鴡G9]wg\S{(ӐִwėVyDߡ-&@e%HzYHT@p[DB Wu>uE=T^'AQ&j "Q 5bWu iR~"S`. Kɥ;m"T uު+c_Kn*,,k?H-2XHPk_cBD|_Eh -w ް'(ڝ;`W!S}h_2`9}';}j0˿DHtiQ)uR_z#KaNCꤤMX;C~q&=R\ vIHb MHfRvhX)?ya"n"s 77QC{_kV4ګFyy:%GE8hH $)%Ig!ՆdX3lXaI"z"lK3W 2z]TUHtnX`dѯ cB+Pc'(|f;;.1$(VHrioP5V^~>C~WW{90 H"&禰|4`wikLJU6酁 L"PԽ_AvYƹg:؂ cnT4g&_L;|vS !e{RK}/WzSJ[@5FPC4b`T) 9-kTOJE/BNrRy91:EGm b{Vʛ\sA/z=Cȗ̕,+z~l\6s8Q8TG~D0]Ԏ`*Du"ҩ#H=oQ%mh*HRqdnPz'HI$@RA4CTR1B 2A$$@PLCDR TD1L5PG>׀`t?d vo-~{/_>ƦY+0]M!>/,;t;4I;le |]ӈ }cć9 itobI g%U @\NeqJ;[m2;:6}UIyayy_uI_3Fd Ho[kBVvތ$g}OFt<NQ=Gђ3`IM>?W]6`щqEqr򼟧HE!%$%IR[Ԟm\ 7lIH`vQGKq PpAd!b -_SVGFPHY'A,(C_#pQE!cֻN.yWk'y9%qsN*"RAJb@S33nۡ~.<Ⱥ{wHykZ]j,\zoxXVd,3 huf)2֠ $(BA ˰~ʕ@9f=N f:(!"rwT"-" OMng"J 2\e "5I&ld*`>HeXe4XUR_r <+RcD蘰#WP2, n#Wַze~sPV bt@Uy`0>sr_'”FU3&BЕOO҇dz#:HYM$sH~'p[czhN<$GJ'kjQS "RZy4PQ^xo-;Č>,n(;aZ?5/j[o]Elʅ>`[` iJ)fp6taB`M%m1`=F]tr1c}hgqgpeMWT@թ?:/bٗ+6tá뙿"sϝe%Su DzƳ5y֍QI񺥩ICUC\rRԑMJŠRkK" *้;V{zkV0Zq٫^ˡeq'w/36!1qA۽xR0rBs?0TGH>MG)09`QP(V^IC_Eo M 6SnoOyi_Hn㬱W𱶴i]{o VL.‚Qphh^cJ^{m;aKao1;ϩJG,`A7a?#%/:pkTYZj>n?x]MZ;@7|λkJ67i6t[5v3HsΡu:pdg z͜Z~r{^ܮ4TfQLi +ЗwW_eL.lj !mZVDu|Ÿ6 ҵtL" N!joc~=kߌU + %D!?sOh~ia"s _b`88.Q᭝ɇ|l.a=%y(BA HW0 ci$|q=m-m';CևPLç) }b^! ąi",YU4,X]*Ǯ@mˋV4#Hr"A!ql|>.VkgǗV;TxۙϫuTgCv.SyUK__:dz-l79X1M k >'j|s; wv/[Yce\ql;*I6Bc;VÄBFDH._/{e.:xqKq,z>M0|TPzbZEvX aXFh(w7\Mb\Tڋ#}ccAcgTb @|HL!XqN"Y `o܄cqmp.&ryOGt"Š(t?$@Qf`+[ XWЬR=LN΋IK D`Pj8۪*]#n.GqJE16DFBʌJC@l}ZrC&$ݷ6*96.z ,5#ڋ-%d.EBjТQy5X6fe2-/zb~kq}$1QVi~ٮ.~'J[gNp 3" b΂S7,,Y;Q޴b7qk4A[ VB%1T#j< 5F"n8y/+؇$Yrƕk>02$K[b'Fk(AFekx~~aϜ}G;HJB~79!YANPP/Pt$ۭw?T4e]:H.IiTZCYFzẺs nz!cE4,蘐qo_CLА{KwύԤT4& >!$AH_gȧ;I'Iw&&-K:?&bHG0HZ ^g#U1]gx$;ГhhH#gCҡ!"B, 8:Ol~/m'l-ƷPr29|31`[)[H$@ô P.;0nb]H>SIPQs>WRpy ГbHn@|"f:P4PT@l@ޝ! OzIEZ<\~r'ns>THRAh687B?<:rمOӕ]_T JP"'חn̳2V殭M % lJ_m+g}: N2ƿam$.HY4У~= =w?)6sؽW>&gS ]GYr{|0# 1| keRq'M>&dHi*M^9IdУc}[*T] q<@shCs:9ٖ"0}+?ߔ]5P{Iލ*ĂL!!>pm t6p;Fo~C^sGaKTJ Q/Y8>#7aOY 7cr%P4uC֯t?Q_}݋t{JP`L\9]2LN{^հe6R )`+}are)y&O5(ipOI ^T/gr*v;΁m?/7\'8l̚ưW֯SN?t~ X/6u9Kn# M킉(^GR.hh!eoAy*j+JXHf L@^v_ȷWo]ʤܨ,^)|jP!IAyPc2RJכȃº.U ̺>"}C!T w.k_xy)1yѢ\m" d-$mJ%Ie$7E>BQ]-VoW/$+Mf4^k0p-*a̋Ȑ!q}]kB^ XR^;ْXLeGѷEO fu&a鳩vpiaéѯ@^F&HGr# "ȏUX|ku\^^0V^}vr}J^hL!zj)S](!blk gCN 8TRE o*@hp2)ȇ3 M&A6PȖ_\[Ŗo_1ik]۪Kc/AkQdC(cV[h|Y ںX N~?|EWޯ! ",۾;n7V*\u,ۼRItw>N7$:ڼtv>i jCu *&fn jvȚunU'{k"ӝ\kUUmZ#vUR4z}rm#@  op[ReV6(bl059mYv~M6iLjGļ9vuxGI͵đyb;sU>l*@{Bw-tA"7-* 'J$LfkY`{xރ_)B -pI$(T% 7ǚ3bCsz(r;z;wwNV]N|wHcHI C S$N9: ucw,Φ Q?TQ̗ifmEƞɻB JAS@zElLb&A RshPf-R4⢨aA}1/.C% Zf&FK]b-kYR zR2Ur1J%)+)T.8<A@퐛ړcG|ni/u=#W}] Uˑ8DADw=\G.ee>#%2)XR\&$^hq`@{Yb UW=iC^)Gi0^JiX]"k*$RT4%M +l"vfCfaL5-Jm()ldFXlg4'TF>XQ2|XMzStGtt|*!.m&+OQ"L崣to9}z~+_)ir(yс䱾0ѓ;УjbP i3 l f -8- j&95΁5uX[\Ϣd X ƕڢȆ @%1p%OcO{}GsaAi/pZN[v$6jC\M~ᓸ\AH]m"^܉k*<mYSx.BPЁ$!u{f!AmEK&hVX| 讨fD]Drp 6 %y-г a0ĝńmJ؝X]Yy[nd " kJ ( $E4P2 !?iW'oׄ @zWNN0 7JMcvUʐsj-^n;|5+ w$uyN+,dt&m2ws8\eW⦾s~"M)VuHJʵiPb3}JІԼa:fZG&&B}Q5U܎Bګ[,ͷ;owJ cv| i oӀL(>rߕWJkG Yuf:9UakA2dbP /@\yKI̕K )h 8HiztG.Y5fl9|_jGP@(t".K~]*-%"$ur"W͊Hj(QFb& bW h0@MN/@ Ma)3h'im2-@kZI ҄N֑iP8!:%/(ha΁>`wv`SK0?6 ;RxRt_s,(AGtVTc?tg\;/_W m%ޞWZ{NeXA\kf a o]bXG}P :Cyps$`oC#-HwS6~GCMPRS2l\S06JBH$ipm=J(@Ǵ~$]=u XD1r2@t9o{?hyg,^-KJm.~;^lvo~U@Km~%Zngt ei a*' B cu]Iכ`|C1rOˬb~,Gp_.-[e1hlYt_/qrqhl5~HSFa,7W:* jikkiKexզv:lA1(G1R:[2FJ$ '1'MlO\Ka]W=N2u,r9zn'YjwCl/ش0x{{K?͹`Pb00u 0]4]gЄƀv ~! 6zoW}us@u#)c=5V=W=7u57:Z+֌VLM% W>syv5zr҄  Bٔ ^3|c8~H -O\parB| gRMu_'_҈>?AW? W~Samuo4NaN'}^hyH_OO kCYbZk%TB.B+gZSE=K*Qҥ3N7CgYtS.k{zJjJnzeKew+'#~1D\e.toCëaR"XJc6Vi/̶pk%.:cRGSnlKd:|O4z+T}_%Y3hNPH?t;R!eoCQl~# eu xzoPOtCY?!zĠvH@j5\rƀ~ ^e9B!9@JwPuw˭pv*CHc-cN#iKm#즈2iŅ3؏Mde병}HHZ]xk%*UOZ,0.'гl1I#0<([$餋Q\BlCmF%:U\"[=z2Ejv?z`ezbs#!lAPX}ov{t@2%og_!ȒD7.@v:_LX!Q'FD#nˏ To-R C ?`Ǭ9$[k!똞o*x yݬ+?^[~kv5x<ݟ`7#j !|?_ uܼ#c^B{I 0\OV1cv* UH3W䧫[k6rh@cmpw @Z^ @YQ)~~ ڶDI~|عԾHZȻ@6+~H8`Ne],dcs5D>o3W}#&w0r:LouH1s~sK^op}и6ƶ,;&{>jY](:R͟q{Dӏ~w^qs QaN䱨X2~fj]t~6$% q,-?8/98:WKk=g{TE\-=EEG3V=uUXx R^Ng;R?~3O+>rϾ[]qz6zwͱx u 4|}k#h4&9C/Su}N=kWϚkB)`s_&w_v6q jAh^݀__ Os%!U?h~?_ZAuyI5 įZn۱v b6^:d)XGD# x=9hF78 Zy;@Z0J8=owE] oF0nѱ͆ݼYJ=k,`2!ȾEGoZ uc<[F̑ ~J9O#a@Cplڸͣ:ow ~E%|~(ZKq(2\CK{NT?𗵭}Gw_A}1X 8]nYdGǐn9)tw)ZN)R*?gMgHC`ZuݖV5D9c3O [#-/xU>=omsz/]0!$عmB 9ఏ?9fH>@qh?֡)HGc~FO]Z}a#}C_)|R7H޴C657h oO,NT}ISX~'y'0EvW_L|挡uaәf=+B@Nc]|Z}sեyT?9cnYpTߪQ_v+ap%HgYZy]җmi~]S wsx>uq`ymA=wqԗ( BAѲr'>.;=i{ݴkG(mnLN󽜗3gp;82}- "s`U#&9lLyTx }ܼ4)v.N?}7,α"83Z.Tf,}Yw[6 T2 0 4{:(.!SZ~[V A!c̨0{SR5<ӱTSƦ.ffۓzuKdޙq  ns;ΓW]\>+8^htlBL3Ɍ/E ĥkH) Y$eP()+/f af;x6u^w)>9д1/4`)@ 0_UAQ)*!lL-5/ϗDxtI 6z[{mTy-}Af ‹1~TjWY'sh2zmܢidu}eY|&nZCͬD&;Ap%`T8 hX $p ֠Q v$U1ӆkDgY-YkJX.MRlȣ hm̧۝#U-x lY榍 1KfeYZ!C@W{O7)FqҶ7kfg.|*>e7ҵRtբfrUm&T6XJv==^*na_P tf"Qc;8Wu,ѷjmw}T {&>Y2* gC/y@r\$<̈yQo0hHat R4$O\Ӡ^./Aƴo\?Ү=[[ rffy#2.n0T#bT~**ri[q tݾ O|'7~l\ܘwd`gުm@/aDzyyU>\uk.'?NOvq(9%髖q;lhO,l8ǝde}fƭ@{6ې? )ǡwG8AP!ÑRLT64Cb)beYZ Ȼv^jnΡ2%a,vI:WacT¬ؗzgqN/~:tzumBGyerj XYvƦ޺MT+z1+kjoG!5X B]\GkzWB Nd03XYjMD/f3G b^\^5^l]x>͈XO++͇~xD|Osz۔B8㮮NTc3(oԻ),Uk-Zq)3DMN}_H07`S|8֕vp|f5Zkؿ'>%gJGejٕ=U:v#4 U0>wZE@B?~*R)!y4(gҧ# kkO"W__m$3G񽙛ؤG|g|}C]}SFR>d%}WXiI{J:O9X$'x_֫HD};U6c?!fܽ еknxXQ07- <!џo|/K@1hяa~ZN?ڪ {ڵ=1s56%LYk? !72Llqm"ޭH@9?]I\ C` g;c vH@Ϫ1NuuɁ5w<̟$I((.V$G`s2vYmVlr sr䈔BT {Kf^ޱDZcW:Q(Jԫx*Y3 .oQpد#C֯֙* GCB nF7Vk;NrO.r!Di"3z22zddyϞJ=IEv}>ݳl" bqa׹1|e(~Oaxuga\HJ,Y=@[, sK4ŝ$J;kz=ڀ=A·oA^A|n,Da}=mM=jhHrn|]nׂ^eQfv0[Iһ"vA;q hr`V\qܻJYJ,]u9of_;,{?qХb15@olOum&m!],næ}zfVp439:γQtmmmg #2p3mhL}rk- ʴx4ԭ?>7z1Rv[Gdѥy׸ͥ yyU~ȝ^Vob$RP:oSWZ߈]1-K13\IsDH9X#POڠRt,vL0%J7pֲ!cgR>?9ТT8r0A#T"<.OKvUyOthL~ə~M9#&?495~خB38Vg+y)yfem~e_Q:5b7d'/8-fP܇Q0>FzZPny7癒r9#S rDK~}S\9kJFK>`7lafaovLBU@)+tIJ_c^)2c)1Mgs>0O Oa(/xĸW?B\{G lgd_P`ZRa.Aᵽ-Wmmm..-!職Di`{J _;}g~BT #g9$Pד"RTJHi5R)!$rVFBTP]fAthiRc4x괃b-}=ɚGoh7=]f^$!]y+ #QQ"  | CX[` ƉڽpA #SwLLG?v<@BGܝ9{?Y PCGicv J&bVϜU$$l#c5fNE}DE]o  8nʞY2G6DtɭZvF@_m06i5Bv!LOlEL&D) o UGKS$.AȤ@,clʫ 3jʫ6νo^U(-8RB{Q8^uAMF꽔2/?-v@}D~)a@#YHG?NqONY]?KEvU"#CD\ʠp)'@aؼz4},ı`'_|K7r6m3Ѭ!ĉRcY-ĭٍCq+e3a=u6mY݇UlZHx{~o[?:Wfi&K$_ilc03^vѺ,|GF["HÄfJHr6c7$ǠS/~ *ǽjߘ ȤКGkEuHz캲 |@u_uřy\0k{ qԔ{㍣@~wX-=rHq=,Bl*ݭlƝhs$ty="&A$D])rZ `:pe7gH@e\UYl\Ϧ4VUn2Qe4OLx9SdX+Hx itZ3fNJflw]+-%6 a3^pgܼ叱ء˻f ^PLo?O4=' '0͓nPwp P!R :FCm&p`rZ&,Ǣ ]zJˁ7]N?-ʢT)9K*eH6'@>+?SSa;䵼y=K36 %׬ t ]?ʰ1ȸ dmYrwuSNx4s:, {X\ 4Tɵʹ1Fdn}%P~<Hknytin]i[ 'ռ? 1B =v ;V/^k!n?a9"r'9w״~"0\pѐ8d`ڹn=>B#lxj}<5]JTSk2AQb$i%yF> ֪:#cwma9%*H0ϨtG$2<:1DÏ.mΎWt힠i:gnGQhW4w6wﵬIY&:sf@; =GQ}_W]OSg[g8xuHAD$96ekZߜ<8I\8֬?nҪSE*55Ev\jim AǑqS:O3`YwtYӓw;TD:p7 Cm l`/L½y_J~ڶ*Nⶹ=CեR$@uug&Y[}[h"B3K0gSNמk?>(c(qǗM4o 9Qep=^1sa]ms;17bʞ%c}"qnnxNk'CD8,vkiFIN:w뿏P~ѮONx@$_MB6oD`N>w*{{7~ik'L8RP -+E}C蟏U9i?Ѯ:X[6uh[9px휪Z:*}K*<ꡌ{'=j7 )޷9LJGm/V?ϵt@poTv%AV*RfOL w/xmm,.7Ir{>FV#[/Џ  A1q]>-,P>>n!d%7wRJbR HLI1E|Iji"I]#[{jY"g>@98@al2`kC~Naaffaa H8LRSڴ-ߟ 稿G|C9Ĺ@I4@6Oa_BYvś"bdN K 3Z]&pֵF|÷!]ϋo;X^=m<kR' ց\"8Eyk?pY>$bm g ~bE$`߳|II?/4H'@|h; {(>|6X*ӊ9XM\=1p\1 1Z& "T9T))!Z4T^G՛i mHXIJPJmAڨRaQeaEaIAKA0Pk0'kWknthafF9 *6cj=XE &q"ߚ -SNLmk}0K9TQyCQX!9ѿXPp&T逬Y0r E3PUN\,ʤcXE0)(bdFуUAfdj ԙak(h ^&=|qv$64ͻg3бwsygZ(PQo=]| iYa 7 Jwsxv_Dup#N}p:D>MݦQF>ÉnL Q4*nzVB=4H]c*\ƠBCg).^@.$YZ\M2W e`m.cbc[S50)v:V:xA8r w⥴`>8rteƯΣ+8nķه7lg23V>ãbpSj>\P;H=]VWZ-+12@U%G,sNjFiԅ&&V@KR)ں;ڻD$R@ ]N~ͧO1kobZ 4zjaw(hmkPaؔ3Z4KOd"x釔ZUf,,&n/}:(ggkffK@{W W&KM`$V2rf| [!^ƣMU՚8 $@1;Qv\$)Cg(?, ˑL?E8 (2R O9_iYeźڹ4 )9*E5Fs_7lp_ Ksu$D%6>Ov[L ^u/]zķ )NU%XrJMc2l(9[r pHؚTn:f|C|OSO7\xd[vUMѦZYŷ(3;vmLuIA|k@^zvXrr|5w>vakSѺM10nTl˔fh}+$+\Dh$/i0,|)2y $9j2Z*1Uw&RMئ(Pp:0:IR ZM']zI_%0ۓTKk*%TVNwupfA'\[D,2c7I?r`thhګW_zCGP +RFD 2+ bs,Ce>&L͜ϔ7S NIrG魣(ϊ+qpKYUtgZ^4^6b .IsOzWD @Ԯnnlok*x/b~:9sSƶPZ}4[( oZЀ.UץZ42.7G̔e=ư?t3 #AIԫgqBWVσhJix$$=HHDeuǯ;GVQyy+<̺c/_)($GG61 Hp)v}h rxe)z" I͝G.F6KI,v0`oARQP)0:5{RG)s‘ 1E! 8׿z~;`EYa(O'ٷw?k0"g:RUZ{ fⴶ +4eԗة"'5dO.\hCs8 ".:I$VOӽ8{J龵/Ip0L>+AF9 |DT1= եN7[~Und?Hc!8Gb; 飻C].eE:G |@%ĥ0 4V5loG?Hn \ y 1C!di(&k3Os$ES%=" T;~D~$EQ3$@VEfWuW#&a㏂i"RM>-j#̔B9ֿH>a_:=L88Kt@.K "*yDxҴ-5DE)"" 4u.RYI-Ѵ$u_|_'OTd\h+# -!^:gzKs _/88:8[!$W1S?phPfłD~ Pi6 @@#Q *}z|o`}QI&?ʉq}%߹ 4xtd׉~?5- ^ˀ,?B_TM#ʎSgrfy; e">$ٸg D>z >"~~3|0%22HhB%?1*4rܺ?5~NoI7F׌*mvIRt(1[WKIeó997odIo^79~_ۮ{Zt_crެe`+iv;R|kJ=)~:Ʈ#H6! A2u}ba(G *DrXŦqyê8ywƭÝXdDccf8O5ŽaA8{3(9,PÕ˾xq =YxS}xu2BVIcl`:$̒ Y JI2L~3s/ğE 6"qI2F@.l"N@ Դ@Ԋ9JI  '"Q`!qh"d.5ĭ~Y;G>?!1k|NÌp<ԶJevf#~ϳ7Œ~|ia*9fҏHdL!lAw͵{ݙkT}It_?Uc8Tzŏݠ򲻹݁ .++3ۄ˴hXZbJ 0"8\Cd#,9k%_wS%g95,9p Aau8wdEˇӾum#hGz&ha٫VP~ IJ$Чk) ֔uu@XDN`0A( d:5sJm PҬFp"%d)H9z]kyre Чv 9I3f.69¿[CY4CN)J])jfMJ*/D/ Pe\dTZO"ŗw_r(n* e a]v`R$((3JQ?]1gKR:F X s#p^JG:rBUKD;j ,v{fa" G@;*PN"˃ 6bOՈH-QNҙAE'A%`}tՈ`{b/|  2(&\}+d]ERMz B^x處C3& Lp Ʋ{NlgmysJbbOs/O-_34T3(ϛZ|$5:1#yT<߮.A; ""蛊"&Ӗ3[G2͑7+f)| `ӌU? ;KAe)5T0o ^NcfdYWkZkL8!R[t'|TkiUaisOM, ",80O1$' PspќZ ]vegܛvtt7tz=܂IN6@A@@,A&[Z9d+PLXmYٗR1tKSghf $C]XY`D ,Ix O0$p(\tfn IK9 HK \X"AUXeH{E Z@j҄  ,dęK)yZ"P̵ؖla# &@ƸC5 LAeiPC(b/p r264l@f^Tjy$K?6 ;E6xa`PrC"R&NZEy^Ê⦇<Ό6WJwI4'zK-z)ud Ei~X᥽Ϩ#:/.NF&gb s,JP>}x_ĖFlZ"Z4+%2{wYmCqPXADClJ/9]MCR ی(}iF]-dKōM#EA Qxuz ๵Dj(X ح$ cİD ZFft3mS)2Lf%+&2rsFdS50}=dzs*$\a{UӨۆBHUOc)' ߑ,*YzM!NJ;CYn( 2/t2qBXeHJ]<2 wKw.8EfRBPN`$: C "@d@U, "A$,ijudek(`73[PQ7N!Ēu5T-: XkG*`HvALlmplɭ8fI" =R@"\%7-PTPd,D;U&eBp  DI%d]X;j1F(ࠅ : , P\!)/-Bp)Xw¹ sXXQL B@EQP`@sҠ,mdhއ@_ 0_ԉAjh€{,@ ?,+V!I1R'Z񢳪i^>ϼ~4Č_+"X'\>Œ,&X-65NfLEpkt]!Zk|(J }N[+{IWUtUde1 fS -qK@SX{Ӓ]ݍb skg3g ̆xY1.S MvreیB ߈#qr5Q vzs>`<0ťj lJ2 l D:ɱ9*L]ZTmFӨ'0C]J(8c e2.&UJUGe5=W1iGz9 e5,(ab'{sN|e>H5,pǿZ齀$k?ІC \, NrM%gy@ʼnWb>L3m0Qg߅,S0vVTG5'jVn:NEHQMfe:+s^I!T G)9iZ u ܢ k n`^%%NY~%-Iu2Q5 B=ʃv+j H"bm%= eU gOE_ए^^arsg}$ߋ{sMơhPsJ4|CiC1ektS/s9_@pܴP V)wwu(PVeer(Z\ O9ֹerdq"9*0#CS7. {Kp9AsIb9uV$$0y%xE:S003'g;5&DɻL ..QBW}o2h"޳( #[)&I&3L`" xSEH #,$i(Tz `_u [_jht. |n ">"+z{)vu"kR0n7xMK9%Q9KBJO=.m]‰(Hox4}ˬ "@oHz$/fe8DCG5$WC* 0ԁVзVk=K]U#1ƛ@RuF\F1u\BV5D@\+Ӣ+K Io@cEźnԩ8AoPt@=Փd9=BZa!5UNDp)1C;h RN/ZyN]ȁzo)I9)Z!Qsu7a`aPF}'5&ەs(nO(G6\kKefH_{,^思[C>^<棅Pr=( jl[v|.sRn&s/.LNO1_X4Ij& dT?0}7G>w8GMU~,m=;S$T9)7AGԘ DjʜYz 'a ?#癯˴,RjTƣJ>.t6SSS9@<~L>n!8>8.l˔"[5\ߍRp"~gåZq-.6-`wOWK(ej c—UwUgOP"#0W\\}QPF[ǦrJtp"0=6r݋#B⻾wX4YeHQO)_$眲>:w $ 6[X[@Q e !iS__ 1I/'6^l`&22۹Y5G=uϳjjq3]?V\ztեW&?u<Ǝ5|DƦ?wE|.54.$QVo{$lP+gؒ]ciQOfi_uclbH"->=/MjSrk_V0y`*1_,Qk07rHxef!'=[ⴛ(9&c;od89=톏e i9Y$BRU\T8r E ,CޫuZ~ϕEAi Awdu/TXmTʜx}L,ԎвG琌8UH ul 2]$y`nzq2]װiz0EE9Uڎ/՛vT31pCT*VlWqMS!E۳k|}pnmzh1W1P_ڃzL @ $ƘPc]Z0Ex"hO]ق1&cݘK1r)^@Zui܋Pcsi/o;R!m?Uk.aXy#ʕF;gKmnī=]nL.V1X\}IOz?R䷕ԩ NI2q6*`w)v^Nq;ղ$#ΨY-=^j7 K!`ו0Ji ٤i|zWO>;EI ,gv*үb1MTBT[kaϼVIgh=UxlL=G^,e `f(Q"R Ul@=΍x׎Wtt}k\i&_fa{}~oeG³_oGN(SC±doCgH W;9+ ZfAxio#m_󻧾nr?/neCӣgxH+.%$ \e[»^9KQgzm5j;|yҴ@+q]yyRiLf;2'nP`كhy1\+hvGA.{{*GLp#P3óZxǝg05V7W_sƞ.lU=,Ѓ]<&7U8 ? .0.@@b&QpC['şEB 5HNSkJb4(9C<]9Bz&{HO-4KMV Js_ \8DR?׳!6Cџ4*~FVYw5J#h8cy"Z\;공iWPFoS:):ʽA#KS<,J+SMXL싨vnsuV@0cDp19`C,B7l>K}znB>,^?G{O5Y2 <҃Œʣi:艜8 ^NT)X~'p'A^n-ԦN::`b/wVToJ]؛/<}:u1@bĢ;lަ.DJ>~^}q[PMtN-$D1*O/"֚:oLqQ6E^c3A$QM]3o!s/Gr/njګBG,)|S {C~/+_![xh5G)ZKP嬢Q;\[:o,.Er]rGA` f(,rP3XڱB(R=HS94Dd:r͊]\rH^/z(MɻmSp!V#[F6(@ $֦6[o-!Mψ{ژ iBC =*`V}"ht15>*2qsMq.SdKb VK+d" /TCL4R2b?{ܪ0"논^ Ө31Y4HF0 !.ߏN@I\MY\ }G:?h\x". @:I*jQ{A]WQ[@\X%=dc8f t$ùC*J RRT =$JRU>?&"5b:Q֭6qYlxw F[ kf:dUչ^Cɷru%sV"Y`o/}>cF|aTݗ={ .Ap#Q$`?r\3X]w<ZoPZ|9`hmP VU6J0'Bz(.ٞYg!2ZʏNy{"o&n:1bZ: SQDwbNf$^}]*!Q0Lh'NB%I4T…|rŨ; f@^rWǡMs1Q܈hUz*ӝ>'b=24^Q"ه_hBב_浘SXfbMb~n_\5<Qy 21&+4гՌbj}='wrvG}yQZTA"Q->iCak%骲'ɥ|3b?qN?,?ixGl~VUTnih^$'b ,55ԍ/UxEG{3Ew%uum]I۬j'HÆP%p3!a)C9A CxfL;9'U⠋1tP4Bu}n1jVH{(׻YcA[c*BĒdt+ =0E3Rf>D*$7yi]|7G~g!UX#9RzP"DH(hͻ]#7(TA= 7I ԪmcbnpO`{[}=b*єU\ .+-֞Nnւ#8"w)ߝx1ں?l7W7yV}s gCQ+~.2!k*ӜHӞZML0Šٚ |-~?#ON~fo c W 5bp: ֵ^b\IdKZFGy Y)W.{;8ù8M 6hSVY3l2QpZuLQ ~+>6=Y,G޻In>E#$~;S5^vنg2>bf)53蚔MYu1ATXケ3uyӟ/?OfxqD穻d.!Z ?jSK(DoP.**ܸVuX援洀HIY<-'+Ĩ@9 KshpFq^9? 񡐵Z 3E6+Њ$ ND>ʶYN\a)^hmmV%>w]9B/Ly+ݞ=UR7Xz g29Lήۨ 䒶RrOcbڌ?ay0&} #w+|үlBގXx&yߣ  $rmC嶨{I#^d/⯮ ՟?*o,b] \֢a q^vЈMnaҞ.G~hPu*KO`0i62Ha,'Mw,Dr~NJ$sy)-ǿ*ЕtXH|ޯ ՝B'.?ʡ룞TQCH\b睕c( ۷˝^ޟ?RYSSq{˧Ǐ*sNkm@({cPPu^R!%SQBK_!R C$ⵣqj3JIqy \͎{ nWV{پB9jLwY4u"o:*0+~~(up89$siQitGeyӶ6߳&凘@ GSGe!iPLEs| [ɂWM" ?b?!B?{YiD{,h|LL=Q"Rݥ2t.,;ģcAx2 t3>OG'a>7&f|v-|sGOcQ!1E{k)&u >Eoo>B?Wi>k_od45L(M `HIk DW^ߥ?S"}Ɣ>,CD B>JYT.\NP iYi RS$(Xd4@vGQ*SSjuE{L_)^*c3 c!0s$Ϧã;Ti0 i-FvM Y1,[wד2JTB&2m66 4lQ>~|.WyH,x5SF9 ~`h? sͣuBD^n8l)4BÉ=ttq@9"*|&%V7!٤G?} .N f="~S`:#%)&aQ )BBƉ3Y[VjӃt!?7"ȕ!8q~g?e$XytB@>' /TfZoTraOdS3\!#Z-SU@1˝~ꉇzg4\7G,F*H03 N/'tQ@1[=B<3q&>C2z =HqĎ*B`=^fw9b>ca9̶ $5k5sAل6F.Yw9#nkA޸ǚr8y}d< >[;f(0•DV?/'澳W[A|eSvߛ.-#?5rYְꜤ'кۢίq!iK/byc^L v݉),c! z,z&ÀdU4#т?4,3qaM1Zg5yυVsBTH1J1e<ꝩȪ:1tc}fjZ53 @1WN$?u3b 8(D5h1O}),~{^1F{Xe}r Hk;BtP4ΥT}$[4tzY(JG?uwݹؽ;D@JزajJʶם`>gFV zM'?:۪,2q4$ bGϯW"Ĭq'SN-;ƧBJ(u3GkgO:ŏ9\zWl<+nFr094Bs\fp"D#[ *#&\}T"8=A;3 r;2i 7URi04:RWZ[`3ѧ2P+ށf̒_w,nDf!#FrR(B҉g,2FL1.O{)YMywrǯ>8ғ۟ "G.GAܛ y}}?AQ*Gl@Y_h鹦ݮgž=v&W8;~oWRВR2mL6i(hcy3wl@Cq.OIz[pNo"eɹK q|: `ʷ[7' /)\9dkˆiE\ٲQ6"kqLW4 /tlR@|8t O8VL]BwRwb6֕}wm#пpņ^1y/KO̺'9S7,0pdyJN"8#'3r}} Ƕ!lr۟UoǬɅ&PDDs_XFTʼsXHSwÈ*>%|'撇7w@C=7Snœ_^A?l=`H1n²]=k~-V"I02a)e /κ'^ΧTXg!yfv 4 &4~e-]2"S܂g?2Мlgky|efR 30ֺIy,LDMe@jP,F攸AVv w 'y$EP]ऎy=a)2+&D FUD@OoJ TR"$ecbf&SP8Vz 9r ( v 9CB[;\[IKD67;-/EcJ7IjYh ɄNrMLt pPe8vDR\l&䜙 9E'd4w%&ޅ+_9r]zs |S Ӫt]ćYN)C9WE $5\Y񗄚:TF띲Ú)4R Xw@=dm~|>5KA0'>A".Dv~j]ׁ۸%r'S}%Ҍ4P$qyaߑW^F#!qIA AϺML#|`))4!˯ʮH8oj 4VH:*A$GJ$HGFCR5p '{[Weܼ~W4:+~5#Ӵ`}ޠ3>@F|Pd1A}c{q֛z}{hpu _pIP--oH511lXO,z'|䣒S7oHiA"تǞzd- "2(X{u3ʛm?iVsw1(Ǧ0U7w9T#eKk0ʽ E1 W`;zm/u.1E -rVxףt?/8HG{`dgR b!vpS/ѧ-Hg)` " IxSJM֘"p{v}ʚ[Vx?/%06DD끦8.@,& `Y;q{+rJ#HSS; HeDEJ'W)ikl_| KQi,TM9L91@F6Ɠjw6jE&T w*~6| Ev;/m_qڸ{RdZGY6IFXi0mGe[kc̳n#HY@ipa"}ѼCe;Y$}^WԻ?ٿ"?vBEA^ch0D@$)7S߬j 'Svop7뎉o3ȿpFvO [㊶k5 ,LC?d 5ӕAFT͜qZ51+Vnn1Ks\Ul[)JrUͧ~CjٵrVT=/w*<kMU]iBKQ圹$K"ۆ8~r}[z,uFMK%43_T5a/Jqrw=$&@GE]q[2!cNap2ϧ R$N<}jQ,ZROd ʊFaW.los* S1AzPd $`ˆY-!e.n h]BUk#)^MHz4Ds"(0w-`P#ip~VgU7CQz$ł7YcvJZqwʳE 'M_I !1I)!d:fldM Vu|;+1J/tŔpxU1zlހR;ghUr3H„tk.3Lf,k{{VNn)DBX%s6S-I_R.6̢J! ʂ Mɮ@DX$0k3q͑&c@Fr>ZN,@z(|flr=CDFglTM\^t)A7Hpe$Tq -j5HL,ĢA! Z%]!\eC`\tm lYsȎbUigTD̨skHq+*'D9C ▚fa+-%ѡ}Hk* u6qZb63N !;VIdo v}M+UܱYoۮ剋a*Ժ"Պ҄-Nr$JsR֥hu 쨄&P =uAd ,AĶ/uj,C6Wlƙ 0 fZqAl"4ʊڙgf`()z+ /7W<}"K `?,E HAg~k-ɯmDzt~BA1HKg$Il)a/Х$&, t[!4Luj"d5Yc$<%,_q(!d0^`.g"穲-TQV;;?5wU)ouʧ'w"qի<׽Q5"F]L;c4ZP;awTc_jpKVK_LhBՒ.#F:-4G)*ҌƃCrvm$Dm"@ YLq|M]vhY|+ *EkȣK@VqHu{6RT#pSYۚBMZh ZM'E˱}A&Jc3aѲL!nKÆl \&SVW w mDgłDVrHOڪfEE^Ʉ鰐:k蠖Y" 3¼qAadXʬc9j8k3 Ȓ$g-\RCx| @xHw<_/^N[pPm܅ng`E吸Pi"U5-6/K(͊{F~;Mr Juʓi蹉Gv'2w;*R¡zDT/-!:f,v`Pe pB&ƄE5BbP_fRL#h7BlK3uگlcYHp!miU7B$Ѐ@%; Kw=gЩ $O<8]ç!F$LߌN%7l@{^Y5 p,|\E1&:i B| ISj9\03\ŀ glƁ2\AD0 uDT84r߶dg:tXXZ s^(4aɘC Hf!}iѬ!%ċ@:)L𐊙2eBD.A'"\8F!ЅJHR@hj!= @-2 eH$ % ТP Fb0`΄f㖾,A5B@,4e)$55,/ +,..QIH ֕J#)&^*Z У J & Zh&tAg fqFoͨ7Cj\M·D&J?@{ʚ & \D4B` 66fZis"1afuaD@E &.4bl "mdF/ߜ@E'0^Hb\͆i5kxc7t<ϻzGӔZNsq*\~X7 tӰn5urA{= lT;tm7kƒo嵩2/G9/ ?/P#u]=B %|?σy@b=xuֳi&dIypl} \n`A0R5)3Dvf` 3!q {& = =tC0G=i f;$.Fɂ0xXZ?Fnh$]͛1wrG_Rj!wAVٰ摻GnNV-Mm ܺO3UO#Q08Ok\o8dgE0__@;z+|i$<(χƙeɎ:HRSk]ff7ҁ3@zW{嵙K 6-K*6Yz3wwE sl1Ə GIg@AD: [<k_/pz" 4,Tv{PxD}=é}%KAxwG{[F6: rdNS D* p]8Ւ$1,Gə7BJE>>]%,Reʦ戤hH̆kt WI~~6U{!`=Mf\PhzG4~wnͪ]GAOaW]/@hL7K[o/ ܾ2@1Z[K첮>plڢDI#o@9!#9묂c*dx &uc0i[/߿\$nWmNsفiJ[%gA$qz~64V'41,帕SD'8a (hj`(u@t pd,#[f,#BȆK-}<ɫp}Q\^6ÞyE[C$}T<|5uRsE ._ aa>Zţs@}Zܪ{f?1z]v~5q<'dTZN"щ&FeU7b}&dV&qY\s|e#x%(뉴 fVFY^԰<ɾXŘ|}l8G#.wo%,~S [.X4bS p^q,tX'"sy-UYFDZ#/<:Hoe\EwhUf\ٓe5*?M;R4}B5ʺNUy5X"]-Y\DŽW[1zqS|5`/t־0_GsSUJ۵{83ݔ ?|LoJYUx+_qGDH"Ȓ*!uKcD3㓩q` FZ]'|=oT5 f=WŠoQ.YE>՘'QCɰ5_kP{fϡ9#a?),Lc 1=5,q5Nu~3#u gTKƒ_hӟ#-Ko?P$<UJ6a\dTS|ŲjD,̊Fr_ /IeqVIc)GLBj**iER6J#l)ϒwE{(63Y%~l3 FϿ ;r2ҭSDǜkQY٦4lIU9kjV^Ŵs_}w0~^„rSdGOc4#APaĻ/M⾎׿ƗlPKk Fn],47n["\=r'㖳uI7#Cq./쾜uF%* hтx7A49Wǘ[K8Ya*̋ Շ-@D0ʖl꣎9C!{AE/9཈& 7'XLƶRJ;^urw߷F^Y#E_߂(}a+S5F}IeB8X4[G+4y%̮4WSB4FqoQYs_ >e[(S^h3nlP4L0> J[/9P7C :嶇NִӋ΂A # Z,HYDA~ka&O-MK|/KߞL'2$B!4 L.,\I,:+Jtă7X}&˨&Lu9Xj},#</Ӎ%*2DqLN{Y_~9H7< , Idԩ_Oh&ulm*h4 DnA8""q(t)⒰V$(z6]gc㾥,;wW/%=]=1QYڨ2L6}c|'8Aйi)~2AӚjI3+>'ݺBU,R_`K~cGՕE PhYitr(lbO\t~f4(kcnqy&5?Ho|m񼣘1^M]YX{2mnql8O!e{3gwyu8#hSw=G}$1$o؟Nl,0;GXp.-j(?}(TGu{NL"([޳d)=S,4bA$F6vy{R\ZF:1Dy8{ʗ>YM1+9(x afbf>dvnta2x@bgȪP T*N IAA Ze7,A%??Qm|/FZj OO-zh?멿R[pnDx^ol3;t&( zt@Ie&IT벖J[{Y*xx:jp4Qw #?: NuLs[}y̮Pib :ѳqe oÕU%y#"r~2,a Ÿ#4B00LGG|9Ն1 j+~Lju*qU+*s@ưYZ+aA2{ɅD|I_|ooc>02 x%9vgR?ټoȍ;A$c8ы(ܯ'6Kǻcп[>/vw'9~&!uT]EgiРd)K$:S9 V_so۾h3;G:g>nyP/ cV4re߂|pmK uW bԫc( mՠg#HubQ ,Hcn%e-UQUR@;te}9PNgvhdZc1Ot2JԔJ/~%j:,+9~߯vo*v#X7 ӡ A&rii̯r^Qxɠ@3,EnO]V$p5efaZ; |{*߰:еLMJjHXSWG4Dz 2 t nY?TMb+,W) |j- ~f/9ı.&zBw]&J,[zx&tRY) &4Hn:8_,Ŏm3hF$t4\n-2K{sW^'l df:ޱ&۶q}:i+'Lu ǭM?m.0V[ Iwj5oHg/[*9rK0.ʨS?>ә[C{?'סxh_$hnUp-R<>]GE& ym־?QXQ*=tFpJ .@gnq[Y#efJ"-1rMc'0ĞMg]^i121Y7}QnìAOa_gsfg6eĒ .K>)>z@3e/J#pXue%W9(Z$3}BQZ~uަ I {\G5Bn.MS@HʷنH\^*`N0`& <'thKu.k^0FWjFnLKHQdtt}=)iZ3~k:w~GHerύ%TT^ $@թn@nJD^ni=ϹhG)xeSztFjQEaugdT,+i@mEc/8:1~H{QK:D3R V9Pӳ(*|E>bu:3 &s&$K[ilibIM$lnh:Gq:on+p<*t/6Lk;-p-~+$ʌk. ZklE^1a:㘩a$R_2:8Ʒa^~T+U MJ&Wx>?3,._?/d2ϕs 7<-yʫc=CD%'ІǾ•^fݩ覿=l%z'Fj));# 3-+=v~~tp\rv7eb[ 0o)}_^#<]!oIyqBXL-vfMt)}WOKZTJ~_nY~ciPZzx2~/-_}[Ѹ=%""J9y=z_&9<rLn=d6v0䑀G ̓'خ-U'n;uLJ꯱p)l'wbm'4R0I n. #Ax[BX*A[40:G 7l'[d#焥B=TUڪ6}S9m) )EĶ\G+Zk{m]Hj:%rg> hL.TOl3o0s'k^߅rgq)R^!Q=|hC0U!}7N ,HQlJU'x>B\95zN N)cq,s N5gP[E]+(t}}NfKt.>/g:W惒>|Y@H6Ck?~"79fPlD4[nq"Cdwu0a֐0F;7q3y^+Wt|ot3 z46@|+˹\.e"C2&69!vVNWiPןאFGxw-w'2m=`Raag1yYwjG?1B yX>QR>9R.z;}ƺ;y[Sy!B<Лpx^!@^#!$d N- _"cTI;?#ZW f][67ؿWT2 y*4_F!!Z^N`F !ɜdǹZragw @?8[x e y?E-s=_ui^.j8{3ءik*nY<۠4/lZ~mլSߟxg#|d S"NiE(H.E)eh59t}IL-,Wa`0>ZTA֡Od(2+VzO oJ 1SLr-]1RܕVeKf۵XVk~ 32;;^61I0#ȒpCv5DVkʑND`MߦlAS9CZtWGl T"!d 6 IX$ibd~?|8T{;ڷcFIf6a;+뼯v)Axߓf:kZnY`cўabsoԧE^gȏ>j:7t:B-RͽˌpEw[*(bF,-eug>KAe5ݸ1 d)]t].^Ssae3^ő+K_7?KY/;?\_LH7#[88 wZ9IP:ܝ@wQgf#-AU>P>5x{YyXSy #\q“ΐ 4ݤ w֬d;6aɞv;FvuBU}1ArqeroU9OO|QyGO|ٷ|_7਎#I;3O?!?e=d(H<ư$ o:ŰQxK5uz^]8ĊtKX=[$ ߸{x5j~q3W'xq7&Ceԃzg{7Sй'/Mx{ME#'d .*uz{u=6iSQ)ӓf;Ai0,sN\B#ߥ?b\&y|QT'2Ҝ/),uB[Êȏ(wf h-M*u $ut= VQ ehu/d(T{ÌGJрs,uTUWO7.mܛˊ1 *f|= 5M^@N&H3 ~66Z54TZ<]#3g{4Slc&"%˴qQNjUicqD& {!;ѢFqЙd2U@JV6您ҊsT!1N^zjyXH0q:Pu/Kuܺ§UEW7d ,5>}HXkS;.g5UCߜV| yu#XM#jDޙ?BP]R);>W\1[N0mo\{KÃIU걯y;62Ĵ^P%t1NQ;w! )աg]_8ͧb}F1pxc3& KUh<Z!wUή. eslow"h2E 2<5_iH]r {9BOqE|IDt_FLC‹TiA;*h<;+&_cbr }dBKpd;RlD uV}hpw^f6ՅG#xWI-˚U~u\a$ǠK."͘髑Q 5w:.띱}}Ea|ͅtI'] v:jz@hTH+Drkzq? slYMn?B`30 "f˳h`Tf۾3 BUԸ49 EEjSxaw;;ǵ:0HClQF;6HE Nh!7]Jal"( 5{kZWT n:eK1Vz!n29Ew=c}w1(g*XZrdQnMBRC6÷HJ7[hTPil6&lX]xa-K]أjSM#=5cB@TD髦k]]cNuɌs@%cU8dL"47yGʟeOHp ڵhIRvҤbϽ[24XH].&aZ'NU ƭPI l'ZkkJǦx_q2wMgS*{)I1:}-Oc54W}~Ǹ䨰&ntf[Uzr%CAy ՍI Ά=v)3F ^jл*T1'rSZTĒ%Rgc;uOtlbhe\lZ.KM|5L]⠴d,Խ=r*eH2SUnC- S(E$)X܉_yFᬢSGun֦V1_Rmn%ۉbFiH\+W ޙ{oHsF[$rMP%XOeecR΍|I%+ʖi]k$R}T>۪_/:c]z&$@ g*LEf(%+EM OaWOpȇ&6n½j^R9)y# [V'[2z3.|q#,9{%f?l]B^fĐ✕{|tFqBµS9Շ̼t4l?d,Dd:|(~R<F"K,wdM63KJKa"8qG}5hJK*+To?:"b (E8W?9>OﶞLW㽇ѽx=ɘBc1o߷^Kɇ?Yc 5ij j"gLU,ĂˬDw"#-)Q[M JeކPDuoQE'_gD{6B%\KZ|ulֿG%Gp1Dj7i8 bzj]E.JG6V7YoBf/)݆o77'჻|vSI4 Gf: znXl9fIs7' 7Yz+0u. R} D!TܕPR! J>okSu}KkMEJhGTogE4 K`8YCGs;QQ{ Yv}OG ~k124=v=.n/lh&ZӁ}UiXTgX,L 3Q@H@•lL̐oQVv CYYtӫgy5:wIK/DWz&T H)#R/m} e<"p ^r ,wFg1FLt`e`8Q"!(LA2rܦD;&DVs1+ ӕ)TEl[A*^C$9,0e-;bĂM8_=&k|Ά Ygz&Ҡǜ*3XQo }zF!|0~O4SAU]i'&E?GٗH0E[v5-5P>dzL8bKՀH!EjYcf@ނi$ l;C6It/١"GL2Q}S+}jhHF((h6ոT Ql~Ր1S,;9:xVzc"?J1%}1;YԹxv+ Dn2Žlsi>e 9#u4dd~l_cحsij1ň9[ՙus᱘Xb(BUbmW>E+Y[x84e0nN[?,9ZZLf$>uoYP/S g؃ ;mY(~Ę/{ߦ[A< E 9RAn&zs,6ښm;v % $aفd$cEsH]I9Z.,2zttB2?n렔N1b}]aw/ et^xs|Q>a.;d7ePKi939fD1,~&*L蕺ǓTMƙ[{r!]:& !s&^ NU}O]We+{=nqi`{Jz_GGe\^R'mou&KcOϺ|3j򼎋//rR&y,W⥿C҅ϟQE|u^Rw*6HF#qsfe%xow^ZlbDA~G\0X/Jcc5qbj KNࡲ'{fedC{t@H-XTeobr _O[u7TqSsegjqkP)fYK7w\z "2Zh7ɟh=<u"pt(M9 7{ }sLc_4|jTJ4F/U\SLw{ F2ͦ4πJ^ZpwB$Z@j4THt2ڪjMNHZ_vʴj暇yuӎ] T(wVv55pk֨@g~$旡!Κ!UN^)0@yEm9GO)U!"ce}(],Mm ,R)Ԁ%)9!DEU&"@%S>M>Wމ#si4RJdMő0Ǟ[9&fzB 6ؚMsў2ƻK]Xq=f2a4%ԧI|9y4;"r-Kd" @o7 8:8K}rX-/(R&ߺJnY";$K>o{k{6Ikj+,w CpIF+e~=ZyH*xy>DrOlr}e]g#!܌mU?s 4oڍvWT9yH"Wjs&uI" Al_6B !JWu^uy޿aw ZJCknGh,N{ Z >|ïuT`ǁ&Tb)[1{ZәT03S#enʪ`Rq.G')}>q#^s20j\t{Sgs7r)ۊfk`4jS_g8IUSi~CU !3?%Y(;h/'Dx[xP+O7pȿ ܭrE: N2_mjAZ:啹cWwfH\&2+r!גA]@YH6+\\_H9%VΗbn%L:WF..!RՉ;=J<.gO%/u"hkeiEx381ة8iӃA0WpMՅ'XkXiDa-_lk>M[!ʫa{7 Gi DXYܻR;:"AF?jwynGK5׾ԇ@dSf#&1bN xf2Z|waV«5ԝ cQ}KT**='.UDiyx cˈۈ%^e"f?6U*^>^| 68m$! 2G1sUi>:E29q}Bds0A^qKϲPdMZU:գzyʛmu>#!w%fKGݿEe?]7g+is6X׮:fhAg8feCӝW*/ԧz-9\_V> {)I}'иJIAz}ÂߒIOAzp&d8VAA$,vW~̱yraO2'nH!jelʯ)bv8?;W;?,}o}Ml]K09. FE0'^='pjq3Q 1pS::tx96bbڹ=rBc`A )Xd o>Ce<r9ԹphyX&cjwkKu6ѯ5Adl`wv݉g)ł$~Yɞ&KoҚd YU̍=9zŕDfuF"~v Wi[Υ֕č A LbܺRuB[pj lOUoWR"yݗ:Kn[Ix3n Tr KBHhkyiٷjr_[=j ! |g;l/E m=6.j{p#cvl7*K3"N DT~][XDEHe{O#hcǒfr (Z_e=ق ߉9#zsTh:YIW>_&_R\`@COj( oS5ɰ2jްjcSY .@?:5-z !Q2/go|4N9É n ]v#F9nn"M/7t|m,6smgt;naZߣiXo-Vf;6K}KbnLKDFن0"Vܼ7!ҟwNW{H$~o8qo0( 33 i$!7duu+cO|MފZĈi6$ĔGk_5>S/*Gk;F3$S֪ }wWwEgłkN698 )]-jc @3spxNF8Lig{j=~[ޱG7gehbzplGuz5}ϊ= wK@P?ݧyĺ\JtINOkr/iP9;L _ެv?N#Ѕ7C}ECYFL]t%]ӜVϚDک~h;>,EeOHn tJpXxe(? '"B>>Acy3D?7zXĤE4^Eh;廎kvw -/^2QQNӝ[Ħ6zZ}UiDeefetG7gX0UD>4$&.ubp(}.5*%y-))yivu ]e aaT]=)sOP(N V!2(Bc'x4̯ŎIIqPg='b@x,'н2-||_1d]9vI?PO_A'GtBDŨp̡ʻ§Z ";kZꢈѭa tcBt*[hQ4sx' q,*n" NGÒ#(bL% 22<'OgwY*2_4,xLc0&B.X<2*ڟ~>I/REYb#$ L DwFs\q ~RoEI~ zƁ;%>Q wc>Deۉ)I 7<`:?J#wӫe}M`ÅueAzl/ [eM3+M*(s?zIiN*D)#%,1op6##f͡˷yݡ;o[q@I8,7AN tLF#Ucؼȴ㕏N_q\Ba!;m|N [IdcRλo*ti UlRM _%%I8p(ԻmFS?!y_T}TV5M> b?OZ>v٭倧{ YT]{=L =Qǰ/zs3r>W;rKg^8Y (ma+$@*r ?Ah) 5*1ussvΝs45e,;1:tɿ#?6CFk7(m"]1GY?KSȬiaUy'S[.`Z<˴:u?{TyaA^|4^6!uĵ$hdm'وX`-Pj"׸%,ke?R1x0KֹM:V rCx_)Bӣ5,SS8T\sm'AZm9[[J<ʦxKG963&& tXŧ}k 9byblB { sO"_Gnۺarx :{700Ϥ %o%Ua?!\ҙrh8TRFh:|o?3y\?3߯?&wpPu8OJe*$a8\n!^/uf'i9 v8NJsitu]@}sMv]fg@U3v"KY4m&ƒ΍. Z()0Y*#i-]D +ܩj؛m?Cv}BwHqNwVsPĄ..88P`@~4Oϧ54 mi_BQ"3AaJ_)QaoM|Meqdеr@4J=N?S$mo975^+zN6z 0kv֑)Xt6Kg\_E-TB}j. ;h?a!`D@D|7w@FUUSʦ;axc%q D+)lT‘GK/0kli ?O|jŗ0 F E|IyY1[RJV֮ET}\$죪ɧ\(uf电܂A'n iG짼b0-KB0%duUd%K!WjZZi}3L ^Tc/v;˙LD4(+R (@̴(SrS(?wE88B!]j[ذ+ۻo2nI~US41iz:wMFѿMMVu>IWgZGpf>Ͽ9 g'P ;4L=U~dq'Es @HJUy˰[p0^(IUD- I]?wȩ+6% #h|ߗ׃ipzz5*?/nLaH[T8s)(Z0P.]/>'EӮNعЩ⚌n-ߊH#$i80I RB9_'3ZܮG34)lr)P2'B%(u`ןzRkS]ejKAEq&ӆt䑱wM$0նؠ$3S1d?[3Gzkm !fx=<_9FٞAxżlM br\.)oȯmj]]Xjxꄄr'3ϔSWJ@t"o2b _Va?^'R\CY n;kN%DG뽳"QlLGD"%+,tG$N` zBc%& Խ7-wQqPz{N6\.-a1iB)EW] &OV8z !&PlqP|a`R]A%=jz@ ]<%*doz\k휕ߍ/1<S *>>Ʒj?zl 'B\u+3}2bbd8!QKPiNy1`\72|r ~R(Ұu`t('`3`a4ծ6孎H jj)5q|C(Y̦GRbRAEόJ.RCJY48 dI2~ls(pSMܮD _";\?F>.+qzz+Ѱ9!w(57ZHHp8 Q`Z}O"zOHsy3$-Pd2^Evn*b"M?ʆ⻏FW򋎔LE*BLIMFqJa$LLE5M>=l?I#:A2AvzZU!Ȱ; IpZo!>ѕņ~|Gs;33R7,,ӟVq(NR}&I^jʐ²4hꄅEyPreD ]\Տh7m8z" #3[lV/5K~[]cno! hj}Ovnr LBUnOQAF~*\(RuSv X:~_|Q'@VSE *^"9򈫻pAhN(l(Av:zn,h2O 9_?%$^^ ؾx_\otio`|D?Kt8ٚ',8/JWB.<J K,.,?QҨ sd'jau> "g{_N}ʼnoK7ƾïK3jœ d;x"ן ?E\JE3fR9n%. k,BN@+MުMn3m7*-_Ͳ􇸡RF%2ԥ{Puc޻0@嬎.JIUnp)M0L+\w@S[Wv6)+h @hޞ'+t^ ++ǽk݁/7Kyg`tOxo>4 J![+Cpe A? 4-L;*E|5N(Pxү_6d> & ] $ >XJ\q6XO «S4-:" KYu&l`j$Vu!zpҰԲt$Ҏ'XaX V&:չ.HrhE?9!yne# "4~ EÐa$$I;&~BJk8wIAt|.֛8F\QKiַ5t&p^Gjwx$8]c8YH)Ldƌ=ZjWY=y.gDaU^DfPb.\r~IcԭKq洐 LSԢICL2DT9kCW/.6=zsC HAnԋ~tYgOR5INRX}%u;2,A.{RXBxF1=}/ɖ_GsBw  vF3 qQ 3lr3 f(MZmW©ɓjJJuO{9gVO+4N!6ZnkV\3ɔ9 &D̥oj٨/δEk" BiE [k&u=Ԕ#K,Q)"3CӸ"lBcv!(sA%1m6H5t3 y.@fc>&ȘПWߝFOv';c&r90Mi_:6{q:z;/UWH=AqfE;/zA:'k^hm=xKg,U8` +v 9,(jY@HBwh:Vm0Tu9iA< :}Swyi5INX;-Jcb*T,D, R$pedN'9?ՑRddY\wި|Җ?亯SXRN/A੾tۨKRa:fsi?YzCV${FyzohqYd Z˰:}nXg@z+1(^a O/Mote|:<}^%!hWt?0ovL9fKp!"/ n|zRr E <ɣXϼa)>/aw ) H/ja+"O1o0Z{mNClV} Go'y1l.bK5>$'C ĦpyF#R&#E`%& t_=q:hW7 h&v.|= "C1 亷Rk% v8>Qunt&NS[$~>_bth+\.Rq# =8lsc [$Twzucjt}zWI~FO߼e'|APF",_ynj\,-d)kWˣLFͣAp \zG Ҿ!#!dfys jJ1G*u>`QBk![:I_9~ZWk[H9MS,r=cGH7Sd7j_F GhfU{ o(J辶1E-麙1V7N9r(_*zk LvĈ3_ch R\ˈ l·0FvfS}ͳ b/Ų_H+VaB#ʁd} 9O#5ōuq茆NLe]XUCXd1tz ?9EmxȜiz4eOQѸFi;|(K51jH^ 7 SW_er1cF5v榄jS-.dip{UzL?cxURv''JPzDA)hM),Ws͉3@V>NćN9<:7 H0&PF []*PPiOd!-9d&6tcңJZ FN Bh<e_ߴ3%,`@CAJ4!Ӷp&a8@5#Yr8~QP'`3a![Ú> @S}K4J4%e&?7h7n`Bl#}G"2iZ0 h+PUPeI]M~TT%!hM}zs)w#vU='ouϴRĠ?lOA{.P(*L8gU3\ ̣Y9#]KuIugڛS^?y=N4Y_NSIl7ß(Tڗ c"tT:;P]J4OŦɎ&u>yL9mbӘp.aD^x5^?_(vi.X>aa*L&er%Op*8hMQ9m}wP y2ըCEN+Uxfa Z87o&tP`N dXoaTu S'g$nZӑD!-#r:Ά;&bqc{®Q,dwq|&h$^rtf~\X:)rw}%Gɰ4fCpL<&.+L@yBYz^@ÓgIjCZq0tBȡ,V鰵OG%ZAY"(cN/e pxcGLvk@es -76߁2Sw-~Sހ--hO@/"eqCѢDU\\;91sQτ9 q,}٫d/w7<,=g[O~%g`L x[z"A>s&(/'3?=1SDj7'FrF+# <S/Kav{M 0Q`"H"hQS%c+z;QFA'7ptJj9/I DMkߝz4ٲ{oD>`5οC29}ˢNC"f"U!Gt(-C&~fA$ROgߊØVSeNtV=Qc*N-T^%jGAM($:0QUt(ӎ-Kd4 g6;z7qU+8ζhB.gEf#Y]"+3WE)r18z]]0%ܜݍ;ײ4D<%ʳy0Ţd l;E`C;s y $iVtaKdNPsIEK3dtOP[l`J"AòCڠmZ$Y\z jh+Zg6*RERsM`sA"m|"˻V'SS%jHsU#LҧzqͅB qu|NȈR{ֻ?I -_E:#[O,7\?bAӌObzMhFl{y:\c>Ŏ}\QG 1qh@wh2ƫs ՓA'#ƐcAH ]Eju )щ f~2*x S4ޟՠU0C ,3 t٢1ޠH2!I zf_9It)2|J OMӺ ,}%d{+^Px8%xL҇9T(U/3qIСK^q@\M@>/f@kq3݌)4@E&pѪRX{44\#ziPNZ92R)qYUQ<,)wƛ \!Oy!mDݨˎ_@ݰ-HMwФ"5CgJ-a"-$F_b-yk]+űSЦ1Ft &~5 P*.mX. M%ɀr lY*MCG5瓌a%Q-;V6WVSfJu ~˻1-8q^`JZVm#JGp0RѦ)ϲQrRABtV*Nqk,NGsXܠI2yw657uʙb$ɣofa 4\%wXu> (A1'^J؈SouXgÞLeSD%UEd!K~43q(q ~6Vg^bHȄ: Д|fʩKxٳCK2ɍ=W/:+95pbcQmo'|_(FAJZ, Aԋ6pb&^ ZLקvv9cԈ痭7$Ey fiShu ڟI݀Jr.,ů=Ct5@!Mzʾ(?"Z^"KtrO`lLcۏeP+[CGˊ0`ANp̌PR)%mD0E#ES[msv!Dm< qE30Fp^2y_Js]?XoIzV[neE~UAc"h7', 7f c'/r (_<|`hVbKC%`*E{ yh2o~?~%>5l'Zfى?L?湳6ǡ68j 5@[%Q#EB}n'BGOJ7ļ)e(>IPGJ㙭ϋ赴2KTX=QrHkJNAX^ND;ljh'a:r.sbSV$2|HlJ,Z'Kه)+'sN>eGL_{92r1+p7OtI](45&̈́fWAL|بQQ-SSV)mE]T +U+<}FUVB\}rN%?WILuͶ6V .{Ʃgvw[=RscJcy[όk 3BV&>g?q)`n{jz{" sg2rr~Y tn2ZCPfi@>ݜEB$GzP hB[,xJ4޹cTuw4tIRM{1{{;:  6Ly0gљ AV2n4 Cik{|}4L翚fO=?OzO _;n bK-J>rZup*cޞPB[DXUgyTebfOdnj[M@Ii] xCk7Rb ^ (/)Mbz4_caLFZԠ8ʠ_i  rK*f |yn7D9qQIX\AN>]gM ߻2f(ߓ!%Yd˾٫1&t(,$ۘfbzԊk%~"s}L[@X-8~ {o4:[9ol%q7ywL]pT*_f5o!5HLٽLCwkN>4MpYi1gX it2f. [LÜ-fHpI9|&Yf@$ 5Z|ӵ|`ʖ T. #Q gC0|yLK;)cJ-{zi6&#t,,_p{ rHo~ 1Ra8e^o+,W)kz'qvi*L\E[H^;lKޮ} Js+ysWa\uN7+ CBvk tG qC4壘>Tp8fxJQƵd H Z-` ^I3JOW? qi`7t{]nAK-ȃ@}MK诇 Fm@&ɝ /s|2r%Y_?0 rU.(`I>aӳEu~?\PM+w/.8;A|tb6"p*I@Øb}uX45?,5ܯ敞]dP Q3A>C܅pbwzvz(VCU!iKjd1+ eH"-W%Ja9k#E\]jT„aT_:JGi' )8A#Qř%;0L?za n Y({ .U$iXb q To%^jQVj0,'To!sd{n7.y V! Kvacfci緉DZ4}hڨzS7 yɀz"?Mjy|]( se=96qc#{?<ޕWU^B+Ke9>2 г3#u/DS<5 2!%NY|VK2b52t7`ipʐY.&ә{ ۥf7v-fm-/lJD #[6di|Yܕ%qHIl\9S)jo]sb[Y5 d}i6u;s>@D[[U#JҁcK%t0YΑ %SxIP'Lҡ[H}#nw2% 6Qy6^˽>k+j39VsI!f5 { nh-|޿^`[^@(/_k";KvkHt|'۱\U/l|xA\TBH*@pU7۾e2)LaJIrF'<▢@(/r#BN?)@7͚4r!guw&3,,E<)5/aޖo' AW&~p< akI(fr? .;x7<*f@^pwגgmMתL2QwHs[,I|8gﯼlJiRA[M8c4G^y!T,dVOѡ|H14.Y)= Qe7?),x{44-ƝsЫ3ꐠPa^3Nw~illK"Q3vGC3[2f'}Qض q2*շ;4ˆp1 ox:pf(D{F.g8@&]6`{!3_6|aLQx9ӻA3⎳I枚-HNb~$ u%T\'(p*Ihio=lB^2p|^[ Ku͙e]rR%qڛ~c!؞TKhZC{O3CZbFSuL=lXeR TfyP דQm[%,zRxcmt!pCԧf<UNJb@.ۆWv,#;DwAC )r3ZN]=&P^֝bt*=ݱAwvTa @xSͰX0݀I;3! Ā4J%]ԭs;kh=%w0+b^W6; R |x=|(EܨpB0lF]d|a\D<=S]p#]ȁhlk) [Ŧ+/^HA$L"I$o,l F 7?]"?Pn..΂#hDJ+ф,mWն6;JЩ-08I&G⚦Tb*lkثiٴim}B]=~|9sW@ ~sr$OZ8~6:Z5D(S E"wĪqp>*Zxnk8lQpRPD-y9P(x?4KlkSFɔx`w>%NoDqR]ӜHmO SJ0H {2A>,d}#?x3ڻ=LV3lǑj7Jc7g_K/R)Ly`֊.7y \QC[w3M͸(̚ A7,bsqlI!Fxh2<܉wɔʟ!MHUksk#9qlCD;qnNPCU gۼU`{ýcȏP.g/@\h)M$50R:_5Iwiwka3M9b 6U!G2Q/ήoi%6:iG(s. ipg,hcF0LFu D r۫TJCrZPZ5^r<hӓ{:kVkEP7$Q^r`mM|j]d ][Ì)׮T wdy wdMsu̯YEl8y:F=<&Vy;% 'Ar}`B_h>r<NɜDpqt{{MPt,Tsz3pmw<$kkfaAL *_2`gXxÌqn+kD(bԔm%lWXs;6yX^ y-i/7"_V.JMLs|)T Ϡ Ӟ0}Gss$ƒֈ?H9K;R[BkE5,5eh^ބ-C$bqs`fS,M+;Oѕ4Г}aLq z'W#<;Qdg*mb 4~I̒n^d||?SVRJ :W@ = j?>Q M5#-ȣ6ƀ9ċңhάhC57Lȧʑ]s kFxS&Fȿˈp݈*kdw.W ă^P=ݧt=5N'={c{E ¤ӒDEk܂EK${'F&cO)Ua4F(Bw#LdviYAPҟ]Xc76A& h1exF"N3b@lN9H}ݚeD%N"=|  _O̵>K . gYsL3dC4Z|jacyKΐrm鵉D'& ȍ87`_ֆ\tP"^l΁Gļ TuPk(iC) K)KTJ?qX=ƄWG.Vϙ>OvϹc,xhX7e%8zHPQ pjd7= ƕUBe"%\xQsKh)S1GX<7-'V ࣒"2D5ByͲr@CU%fJcW܀r̻>]߹T~蕫'`QTxmV-Oh6FDeZCaorI@$bG*NEϴ:8fJp0Y'G 0?R '{~rS4- nɋ65ɖT'Ho[0 ߨh XKBU :|BO:h\ 397/ws2rW0)*S19ߔ;|uM җbzOjГl4ۣ0y\JnMi+FnpM2W)Ъ47&rL|qMrso !Ɲ01b9%Dޤ6HV{ C͙b_uT.g0OZ\xbӑ+Z(p gO<|ּ=(e|!.P .w,?{`cQ܄?sS6JLc}2ٕ9:QA$-!id[6m@ YNӥ-^=W.+]=˜ɊS\ Lhf wqʊE_W-lQUdAg Ǝ]! 9ւ|)H4H^kYH-x*@0Joٮc\!'a'`1dUѴ jxF?;+#}Z|s?hs4 H$n]6=9CX2gр{OLGUl@3BO;NW enF jkz@3Dchr/7 `%oW|47iKcLX!8Hk¥/??&t_̅p35#5vLtx-8Z:*F[NWYyfZDď-dh|}ṩZ kE_pR2-.ƶ,j={ԉ5!BhH3 3GR>TatEw\WQ@v-ZA9yTqinKMHs]Lx0c&8b kfiޖ'nZ{tȻeÜ@PX։U986G.f%j+p`bS=i-G]C7uO5=STLjjjTGHca9GΥV Յ-Sc؍dj1~Ö;twߧqWY0Li syeEC^hdw~XʓЕY.X0wopk3rK,@%ʤ@ G>sN})RG[' aC ('{#@vN19pX gJg% ~t \֥~ha*(Ä+*410W[m:dC8JMB=t}K/Q<ӟJ]e Զ z󵞺OdK딅D+c ؎wo]˯{dub[8e?G<_~)M嗂4 '3"tKR>B*O߽}Jг _ޕs rvƓ]Ys$yh28y 88\1hho`?Ēͣ!Odtw-1vƕm2#wDuBƄi`qQi "֯]5l נK2arEʇ5H(H5UâWWxd4jnmAr뛡,%vβ#4R{iG֔ZE02`R'%6%LwE+zR+@~,mP3vNh؆WړG3Hhe:GsWCIP땆"NRܼvMYXʐ&x丫 {5 ]G$=40Y]3%sa>݊a.BN1h--Ncǯw6@/.p6ͤ80nΦq)8 T%h8mXҠu0fPWBg B\}.lNHÕ&=F+ UѼFfoN45nEMQ'rT/fRz^,dc(B#2{Y0"܊JLǬH^ev kPR%wْ etMz:} OiZ3w2Vy5!1]#5)Z,l |e&W|3cd~D&ʹYK0 Vm,M;&_Broc^(.wi#gMv~ w۫0l˪lWM;a@"D^=9fn1DFŔlbyʞ3, :k#m8fm/ =p?F$w4+T?ԮbLF01Ȋyʴ}7'ˀ^Wuu7MuI4\߰[ԘC=PUOp!Eq7ySw& ш ?^B5hG{:G'AB!>JO˾M~nW)h%F U&B.P萢#|g梣y? (f>?XW(gQK({:TpBz9ސ-YfsL~UQ%6X]tѷ鮩m6'hf0|o{ԩUYs[!&m,4Eݮ$?*MUqPv窕zHx1Y] rij * $4v,]۟D$/VB6Bt Gxݻ_5i_`Tñ;;,?-Bj z,dG2jA|B T+I|־oKk[F̍5u~[sQ6wqF~#lcHp9PմZŴP_&4{?הƝ3!41IKt&dDdI'OH Œ^ /I(%PFؽQϟ߭v"x@n 1"jYظ,Q͖ c-XLؐj*i;ǰiεU+QWxP517=3hTԯMd4ωԗO1m/!,1 ]>zw gճU JPӛq zҰGC]U_qaO_S8;w,Tw2vS׿f ls36^FlLP#>q6;N]dMsWޕ!UMb&O |2 /?/c? ɂ]595Z\5 ؠ@"qw1 e'}R>C21R&`m\l v, 5A9o)#{j& `| 2𑏁uv5%O¶{whq@X3Y ǁ隨_bF4GwHq!t JDtp=bڌׯ>/h"!> Q2\$%Qu#!Xt/2q򪒵s5Z1TG0pDU!B5VSԫh a)]8^U0λH,Ai:K0=PO2ol3'4_2G!-9ö3cJw7 P3࿑*$ TuaL{~*RCA5~]Z P6@ Fh"uMX3F ydzo)l[LN qNz$@-5tx)‡F$m/ǘ3 X"_Op8XC|1@8|NIh RU)U{ttT%<;v7ӣi,tbr|ggԛM_(S!4mvSmjcBRqXK~I_32y7YG?F-宨"G,H gE/0 X (RVZKtK3`?;zlYƌYzfK6zM1Ɵ+e^ô%'k쁊?rr,:Yb4yU:VeI"mgw){+e%ErO~IڋyWo?t .EW3brHRu_5*dp {|K):XF4latLu]:o(tEwJ}0kb+ZF~L_FIKH,a#&S,̼|`?E Nvy0/ɋIFϤU(EyNe*gkOpt>JKMղ&JM F"W./\<`3@/9yS-dBSmfnsg6-BĐ+ǁKA:}A$ Ƥr吝Hh m-t0~jW]0:7i_e'YOЮG' A"Q\];ܝ&$l++eHwW.U?$BAQ14H®(0Fro >ڮ+OJ4Hc5n|!Ak|ciFUˢ1瘩ȿCTZU` 7Bܔ-6dߤd dFS$8yz$l9130@OkRw!?LJ,*7p_qUE;8]$]^GsnFeq7k}V<3ؙr8ar2ƞP[e_PÇwp499[m/u<к]97XXqQ OMw% ǃ.V0f*f=EmgH)\)A:Q-PRX b U߶e'b\B45#^\hTtbKP}}c-Sak&haڷԪRf ԥLpxu:5_aNc7 : Y(:yCQoB|,$0PPH4֑Z3hRqJstLƿ s=:( _ٮCiF}_FuvU%=St`~˃0?qI 9z ׄkQ݋Ye:9Ҩ)DgU3٩ ?ؤ&Ɵ3TE1Jf|JV% s4P@>zqD0! _Lĸ]Ֆ*~%1Oc &ër+Pmع\)=cL]f['{-o*vR*y&hbW|Gt( w^Fu{X<{\%3cfD%ee<]Γc,Jz4ًN:B<ʥLQa?^Hۂ;)!s~,̓10wsF" xFFd- O|/ۅNDҘ@El*c/u2NϞxTn1'(wmli3;Lb'F6}u &x 9Y,Tݛj yYU!31RUNg$MeU.{QRy[yҭ+nJJMn.WW6|7p=huS{+߃AZ8-ɃB3(|Z0mZI(sΡάU[^CvH*Cx3˄F0qm$%W}8*Wv3W 4E*x%7Rs׉ɥ]cPS=SE.2̫C鍗jp?;ႝe>SyY ~=uQ+D./NUj/x̍Pw ze6OJ8,B?N䄸A5"FKx_ -Aq Zh ҟ7b6ǒi_oeK4),襗ᛜ5<n b}D;<97i0R/QK>@l*i{<:ĂKWi: 39ƺ 9i'MGkZ|xem'v\gd x,Ihlhc1zӼżw5`cLD>lrg563xxG|mk|0Zd[te|AzpEYo `=Sl1c s n6;D.ֶ˩8թEdvaR20H6tW_4nmQ3 !V/i-k}j)ΝML8c^fBfTrxf#Ȅig339tG}Q] 'Й Eb']7|,ACm;R:3{'b.wuD2|K :|j(n^>Ŭ_<R^Mw7Xu&K;5NC!X W{GU;XǶR ?GيΨn8 [*j薺F ;, 6~$GJ?UsrsIJbapC~~kRjf#0߲V%D :ۨ $M`e+S]S5d|5 aXCօe8'w7zb0?=/߱9Elݕ>L;pQ~qm"YXg3< 2;rP}jw0l5KTa ܕĆZ}K|Q1lH1?EM+m@hcv"I y`tF3_rҽAVPa I٬H|DJ+7;U@~R֙= #'|v̜uNe]d|&߱!)ҿ ^ N;ҥӵ%yCyl3ɷOL0 MV69fMw'֩Sjx=;i+ɷ>Zxgzzw 1|uu XxN"5Z }TӗI:mRtx%w~+-Q,U >z$QDVovwܦ)Ҏzt@Opï%?,8s:j?)~ۘ:Ҝt?J:Z7p:,>j‚3??1' IN_~5f0a@97P8{BZ: %zx_ܧ0Q1%wr;)4x7XWbaM$ & pjasU-5͇p<6dW^ܻT',|¢EԌX(DîEZ~uZ]+ u0aq| 0=ijN'Шq δϏr΂89iIu{CxS FCG{5l`Y"x+P^=YTh‘@uժzzZ(g@pUogq2*r58n,YOjG BleP+PߊC0J=-bMl=ۖ7>ou6qpq^rmR>y߬N.39+4W-u; ţ":)ـïpFe R'2>"p_)K i{:-h2AAH.) q?q|A2CP59+[C+}yކ(U$$f7cсX|Eu1%:rׯʡ{U]_lwĚ-]5ڔcasС_W/؝G]z)jOSK\Va;qX;_zܪhMAAv\7H?? n$ap&L>}w{^ٸU:D罳074+Zp:E:=3^Σ`Ҭף օcZIe pIel9duY _q+q5pg+z,hu mLuU>5r@ `H7g1%X. T3EM4ByWi(TlV P0u¾16_qlBcZ*p8 :a\9̉pb1oMx]=VJ{]zKoJr v.Ov }п|&2GZLe2?i`$S ,׫@K|4 2=&RF<:xh1ҧpT$W܅g1) =5Yf{մd^HPSQ@l3f2d^)2j|b M]9"tF`x.>.=# U8SSZ,jB7\*%iC b.?Ǒ;F13AF1R0{ ƬϷȖwTϨ!&)*Y[Y BYHUq[!@rnh1 Ⱥ#Ұ՛M:;wa.ڡ]d+!ɎjNmM Ԛ`Fz쎦3NU{K`2̕j6;ulňu8)` m15qEzl's~7kvJ~96ؙVP "cn1qG;"Kʄ0(:lPj_G ET'W$YޭWjwRw%Bo8؝qKRd2hO80EvÂYm2Ꮍ[j (rI9Ydgs96gW; R= E֗X U¸*E * d{:o/dz_KY(4ḱm"+C+7%#(kzgQ EM /Z1V( =[qW5 :K5k2WӲ, >Iv޼"_[P&siLqn`dVVsywr^k碨rLI*S9+ Z7VsÄ[@W=Bj$F$E߀MH3"XhOwE(UY4 jRQS|S J\hR O۩F_?oL=K(.8eZGO_&XCsx+4 eoj${q,F$o3+ǶV!ǝi=̓դj#TQPͶUgXLkK /J(褦Q6OCkGtVcI-e,<&bZͺf;UE ^f /Y4nQĹƭf|[Eb Sƀ#kkBؒRg+wƳlُ]geE܋^Nuh 0!ɧj+n| ݞLt4NN?ivMԲs7G*Y@4eoqe>G <`F$KwnP'lqlK֘7ݰ:Ҥ(/b iTv$6ծ=%LAx |pRg7{d6Krp 1FNTV*i HjƅzR(B=ݸ: G]fx*;_ 2(S#j[0-q.x" /d8 Qcğ3ڹ|M6n'~GKIIܤ0(9/ 7b/sKeR77-v+kI ]EXb$Xҫ(Z0¿?{`u%ܠ]@A.iK3!x4^lr\2-Ǒ6mMRg%'<>D+5Ko8jC=$ Јj*a$6'd5;c0I$hu] A˕z{jyo6/%@fTu9w6t@4i)$|'BCN D 3r`;aKTo cnqb }~(F2`'spDHX^d@A~1S3kDE ^6b vQ_̦Z zmD-pƢh@^_̫t#\+K,S/)/hcqF;}ApX ᘓaîCU%vE1XEfH܋P1<:dJڞA{T^Bl-2/ e?0LpC=;ٝ-s@C>4浼f6関F>(:8cfux>=0;8R{4,DWu8Z~1IDVPiWEڇABh KG\?aCXwn.;]W_l/]p6 \ZV K n"&Y]f&s`;áhѪ>i l0@)m<@j |8"+1>H?ȑY 5]aI`L{*Aq\*EҽِHQB}d.;HƵ۔L>1mATJU4g؍o!̽,[iVMqi[1/HRmANgZ<Vv]|N<7[̙~S~0@ N੷y!Y$UBW6ܪEl@Qb.Sj$ȣa|xBZ/梂+QWg(8ʻ+VIJd&-VjpT(sk@M%.RǪgZ>㪨Oqb]f>nIU& ChXH%ڽ!g閞p\s;ν@p%NϿ0+,Rq4\ ?J\1uoz Ԇs9Lݲ;/g? 3>B1}ɡI;*No6l>MH9WˌBeqnɚCg0o9={ڛ[x QuF&O;I}=AXgX6\}ÙG];"M#{;K`t'=qn`L`i/@r %zTBG/Frd{w!eJĪwb\.\CB{lWj 8I.ԫ\bQX,O5{ʈɹ\Ǟ~x7(Y[jPfc^UR,nȱ$ dI`J0{_ 9w+.= ܯxAAE5!ȌBTYm *GT !7*",aC,݇4VuZ9Ý^~1R}Sg~wQIC2]!DPFskr9YD]pa/tА)yQYH;eWeQT@M= cWO;7P yB,TfY>1|ӄ 64XqjNZ`D$(ςпpfBKn7Ȧ)?T5m1NXmG'+Ng}8VkJF9&Ĕ^nПiO:H$&RG|I1v#uv5͌f!$=c|8>]uqڟ-+b'0U 4rv^8oO4ʈFujð?8<$j ag{PM0jw/$j'm*ငho=׷~@\p,E>:E_;wZELFv93196H`ƒg2sZFhJ :Sa5{@M[yB^smϪn'c^rpuÎߵ,qXx\z^.O܈a;3ęø7҉ZԎ›(!Q!IgoÇ35)bhVוּ rjg1/Ί 6aOI-Ц_^8ހ< FF\@[+ 9{e 22oó`~[oS=D&ʎ _}vxUr1Y:fmUqВ^{ _~gMn4䂦6M$ Qe׭GmO]JW`9Hԏx+%;]3#ډխ ךq'K2=ja֧L{_0ʝ.Q󄃔`IDҲiSN>EvuIJ^sX. 4S[s-=WS%P5V8cBSo>@iD%:i(gÜݫ;WA9*Rlԡ#zrd*)!oƞ7x-:Ss"Ƨ/GOz*u"$r8Ch;ch W;6,MM}v/%23f(G w<r_lZN,sp z;C1#q8 X:": 5G֡: 9wp&y,H̅3ViHuzÛSkz9b#}fϾW)򆙺mTH6h\ir3İfXM u^jc&oȭIc"W4~sGi'@M¶OF f?*ŽJ?~7SYVΧYКt.'E,6maB4j(%?7KH4{w[OmڄCq q5EUG*c*qd&}s1[gk7>Վع~ J_nKr0}RDY7ˍ3yS"]"^W=!]ʴeD9?y5ObYa~vfO,{_Ʒ7@rD1lԈwќK) =Zیవ$gg!Re|XP'$BKm8`@ /Umwf4]P] R[]dťgf9rIL_")O|4ypVǽ1&(8{7ػ9_gT${k9˜N-n4+?1ݿ@Y;`0=4dN/\k؎z"ZD9Qά0T4}>|uaOY[vf%1L0W<źi5*8L=zKcD>G)yM863HL8oG blKdDKaDH98g 2yad5 7Rn t]A AE+~dU~1> YU3Ss/1D*#.y`&IEǠq o}W^aLj6>_eEnp?~㼦 Ijz6@;^=Yy۳-bY\T ~A8xYqŽ #aasV9ǟMlƫ%_G~{mb nsnZ{E"c[ּv!hkԛoDg\kf8#?ȏ"7IJt湈ٱ>P!#0"䒘!Q 7H и'قBT_9abn[='8Zq3v'_' > Ѷ%ߋGY!Tzeْj)@)\xeLz#'2<ݿ;?qh,ʿ׸{Khظ~EGێ=8T3:_ġg\WSw'hޜg}@YRR? qɂ*r:"ljGB:y.DMΞR;/77eP~ܮ1/a e.KU2P/Qn$r1FY.x}_U @FH1Nڧ^MJ^3kcCE2pAt֊vµ4S S#Iw?ᰱ g,,K'P l$H}Z#ۧQvX\v|/y+b'd jZֲީ!_Ģ> 4ݛfeb"vՎl˒KX{rP%26ϕ7gfl- x);e 06jG_taáFOm4~Haj&I>c>& }_zj` j Gb='@Evm½|)5 .$j\͊7=u v7p(%߈QJ. %v%{b{׽qM\_ܲ#ā!UIX<%O6D>(%@dl-LO Kz䘽$< lmUmSDmHbH$FͪCB㜌bOuƢɚD=I. ӫta/cW{D uEƕY?AX1PU=6lKE4jwf8PU1 A.O-nD5tĊ}klqpOW$q"NН[JL9Zwҏ?5e'HT7 &}b.VDcHS\-ne)LlSǪshuD4 K.I(bUc݉nG@oSsg 7KFCP]f w+ (O`XҺsT!9<6|71fb܃>en:#:2w]Lbi*`v*I}>2Z<m`Z*QI 1Z> ָn hV@A'[P6Ӑs ē5KWJ94gW0"( r;ZI|KIToxM_Jr_ՖR<)T\:C`y^ & 7rm^ϝ<9 jVOfQY>wkAWW:aŗhHxz~J4"0;s|c3h g)?){X#;uuߵHzemCC}k@iΉ}ٶA3vr_SyqEb{cS$brB`,W_ Ѥm\mZDJr3 ugVvLesĒBew3&a@_y} g1A]xǸbc] 1B}h_ ,%SF!_gvԁMXKT^J@ Cv'Z>om(( T/c1qF#ÆZ^ѿg }?`1#L&{9C|\ !2 >Ε?TN|ި|YVON<) x-gB߇ ϵ4U'JBCg^J7}@"'A@W†|Cmk\B#,EM?A`2֯W^9>Zy}oJ_cT4Bt^^H;q Dxj|q/Kظu3ڜOȀCzD95 .Z=dž`zȜܯ sIz#u.#2ydF C CF[uәwVA~Ԩ_+8<\[{WL-s40. SӢ7=,mj~L7ϲX$9Ѻԋ7C_ss2r,Pچ UZbZn߸A߰vKk˼Ѳ`$E=FɰTy$IhTy^)#oIyIYy= :&3 FXbC \1aTY{cgztwlBp<ꟽFH_ nꖥp5,hWe&7Ў4 )6k{7]FmcmA6Fv1:wvzB{6|UE4I tvB3|S`D\!+Zf{N:K5OTNSWuQ63ܦ"z{?MǂI 1m#Kxvl.cnxd͂GlO686=Jʛ۵9ʆǦ 65J2A*;Ed㪴ي7Xjᙬ~cғx8Ny>_/|}m#<֔KdXB0zIvK İ%c8Q|da|26T[:"BqV dԏH|ܥM7NDQZ\~w.χzUIizk<\L/нqPln5؅JxүoF+~mH K􎅶mIדB]m+eH`4D3p*\>J">BfV1.qM-̈́>FOm>GF(SQCO 7a֬;m^P8cNV׊h|T4qh^}*ĵ:[-;oK kWK ɕ %Cn>M)u$8{Bn`BOkUīH!U;'63+|xN3}=N俫 T[Vl_/q4 6/J5x 9,!BJ`3  4ODƿt5Ļz) J.'Ѩ6M lgp"R(|uýSmK ~̵P+,8W8Z't0 x˸h)Qgc#ypcj }bě~'  9#S<]dF/f;|VmA9ӧf ye7пNjk-΅CN->Rº2PQYU/ Mc5HsÕdЪ""p m|PX̟\j"6=f ڰvt>cb9yQzXqBS~v<;.YkzMASpC U}D =YJR#n0F7@;[_AȽt`*-v(wE\?)ЊRX%b0LFp쪋DV\' ⹈r w$eXAbF4V\> $|dwAZ FW{ KH0[/x;jHc֞f&gӔv;bMNU5cu`|Z%+{#i??b 1!a-z#5Vc`}hn[|zq\.ۜNJ Tei/\#//8~xER% \V}s9&PDk~q m8,sL8;=?F[Mm$)t}K`[r{XWOBpT{濮FcE^_ u9+@[& ] U Bw6H mds/I`>ҀBy/p2bbκpJfy+|S8(Ðv Vݥ33ٮ{ƺ'7k4#qDɐV~C-`O>? ,zZGx TVDhV&Ք |}hwNSE'X.C|C4UF`BUFyHߓbD壳f !o9ix^%VʔZB/ ހf >0윕Wϝ9j a GXy2;Qpl^%NZv;*ˡ*ud?v޴ԇϩ0lTpbIM]`}Qs4wгȀ񘞁=7X!s1%0#o`G[l@g`Z Yi[?: ES$eR3I\ \tnEa7ay *g &)؋:k}S_#.I.1pcF7jNv[ۇxNyF̡sZ$+|QWJg^l!e䇚AP+vG¶-@) PÍqÙ/~&g/ӏ)Vpae~Z#\řnIfќ+PxzXi7[ Y[7BREI{PQ)p *޿qIH`8dP'3lxRth='ܾ_D/tZڔJsSOٻI,N>`v? xz 8I̳Q)^GN0r:[; U1^}d|_c3eQ3/N# Zӄ&selגS (5.!m+p0t1@>C46Y I f԰7NVINb+l[#2ܲKșv@vf¿r__w|f^\F!Pۤ23(sBP^,hbdMYQMn+MSa">+ u>BG-w{,kgZ&daH{5^I4xd<.v%nZ`yA<% 7FQ:^1Fl9\ %nG:9RUpOZBārfA *@`*HQ^>+~Y-R*t w*v!-bg*[zǎrqtV5<^o60(W,[d/D~|B.ZcK  [=84M͙fb4[{)I!ZM Ƭ( lVq6l!0tWKcs+> e/8Ѭ;bBd~w*5`rޫ}CX+G$"!RA%/toFQn+1P J%4w en1zjNmJoϥ~c6q!Qc%{xyc{lc<lHVZ]x (0(+$ԗ;mQ(:H KFfqabعe *uf4F@w\BVOFg(yNΔH>* w=0yfx\U3NX Bu ': zïwΥa1$SwhN5kZu=g%'?F|* QKL̞$ɀ&Oi%T]*Y.@Л%sfnQU)Q}l|hȩw%xt+1S1drޅBcvծNͶɨ;h7$(1l7@]!dBhL9NWlҔۖiNn5QÞv$ڶ9!˓ d-F;"_3Ӄv 43Xh`j[zmѾv|c;&@7ݯ$_hBcTkX`zJ ۃ?;!OۡsrBA;pht'>Z\d8*<3WK!@j+T&2,̤T ;{|i@`A͏]P;6cFtE:XWH5 úvR޶!F!;|j0ވRi,\jꤡN9>wY13GYpݲu$ZAqQCx_eyhK^xzj< ZrA.8!J;ޑzY"Wug. ,(b_hPS Tj.m`Qf0U.ZiWC>BS[?xp!RWĢk&Sg6BO[ç?[\~Qa+!m5mt6 ?9qQl>ǃ.j>=r*Q;~~eZmrru7zJ\=^lf|U~ Ayjl Dద+LSo:,g57Ky`^S7% nh׷cg!?v Sc-a OiXNۗH^EbQBX t4^ @\yhG(24n6|{ch&N"&r⵲έkt| *pXhmA).)8_.H'b[1zVXbsL03Hg [4Pj#KQ kR.T9M`l-Sφx {"&$@_ZGFRP|?9F?1@(D6TЯc`xwo>NH- |KG$1uh#Hbc8Ra{zGyZ8 }!&>S6 ACm Rpn`Qrs"b=Tt.RX,gF[0Buv}amM^>0BIw֓Qi =i$o˯##gJкio(܂t5.NHCHovI݋T*{"Ń.]kiWV*!VgP$Kwñ@~ZǼJg\`$ڻ8\ZY 2>SΣFʃ]ClGoUy^+{%Ԭ!p1E1H1h(! 6VymV=_iyB'|?2z(Y%I_xFpt Arr3*Md,)T0B}^=|s~E2u䢃{\ʢ؆pUq,|cQ `zk}\\ZiReISg(rIFr&=<*s憃]kqGqFεAeGs@'6s*,XE@Q{#)Xs%(Fx|W_3jmLj\E|8=__]΋aY"WX=1M.l!ÜL ;B5ͳ4h$EI&mA>F%p̨~ZD8h#%R.=:5((T`;&+nqB\O@(r<!HS>t `֗{S +v805Ӟ?'|atzmk*47!7y ^R*eD*{3L"R6}YJAYY(EM+dxIz uxte0 a[<[|Hh8: o~KP9D1KYYt͆6 fo}7gـ@F]9y@ B|D|-%yQ{GK+2t+|9@j u2;/(2|frݩtm&&TGeywx/"p]PaimZhՀM?wsV}Ჱ,S3:%9>UW?)l3w"a5:Cwxz{;m M[=g rBaCm Y<kYV!i/g,xKk>dxL;r7$N7t;1XL$>X{J zYvZw ҡ'֋ ^gA];-_?e蹭f9wH.(:."7'}JyOͿ7o]ğ|g{rWȾЭ84@9?lkGn(Hy>-Q:1ſ)!U˻n qIr| "pi{anZ4 ꙂJҤ\}'%659 i`&؆$jpspZTgr|#0f0)14ԛ2!ǜ%z#7*Ȗ+} Jh(T琉骒A nu ngSߊ=)&Aұi|.PSz?/O˨yHe׵+E7mEj}uw0 0q:jeT5l' }Y2rBFcAP.ӻL=PG) [̌8}kk6V/>3@X3YL$ p蕨;e7UA+= ])C zkm 䢳 0 su QçF~cdع"uB T ʍAA d]a@a`wsoWnP8Eq엛0(6hw5vC,";YZw&2/XAd[税´. )mHny\MgZ#b2XĈ_~ّccJ⧴y3uQ2Y̏ Df(bʇlg*¾]|$W檵SSN'&~2AzbE8dZM̄9p0dAr"TOGCɘd7&HUNy;V̻>q ?lha:WOV,d`=X۴ǔrLf.T4N7;[t~dmeful/8eGsݢ' &K-\\N!ᣙ8A nn*0hqRhN98`?W~%s K<# Ht*@T/ W , %(abr*ؤ։\ʝ:s]&R,K|HOA-jK=aOnClWg4|Ð/C8p27؃ Ī$֧jh̭ۍylt9 _E, kn5>3oUȮc673"DPW/>DuSK!4oBZ9~e-*2+xo#e(H^{)ݝ[¢Nj<}]pPKq6Ʒ>+J 묐 }zA'MF`e"uo:g߲ S9U ܑlU[w7BTfΪk;S.kUho- R z7q$ 'z-k5x-)<rXTp&sv ?ּw؞и@VFNm`ɓ}JZãA΃y_p/䢼  2$YQrV%SVoWqFK_C~7bTD$0-D<4D:-+=cn*[P=Dv,pzM-W q!w4ZZJ$:#P /Sl9_bzyE*~ 5ڮB2ݛf!+HRq;_A2N\m9КۥpWhuʉM5Р5T`yH1$]CǷ1|wIH]vr퍌%>ZuJ"A2K Ŵ|0ଇ-ϟpK |UNGY*4ѡ/9~Jd$Olf{ڭ]ydw);t<2h5TDaSVΘǖmϽ(]TA<&Ёpc}kUT wD}QaVR)^ Ff3ǞW]̒ŪOϯw^#r=;)\G^sս" tIokRt#f)fT FGϿBN]Ln}g= OP!HM۰ (Dn)]#VWhg_wԚ*݀0DHCW5:SU\q0>[z~Ayaސx(YnpbvYџX$L8>/9L M$_4)]`p?!2OH)HGx hS8*SG"ވAk;ƭ(b֥bgT:4z3h (])bc[QOɜMTQyc,zqy{jpP'Dw$+{|kwµWyuM=Ь^(XV`e7fs!,~-)=i^68g1HʕvvjCb'WzG%z``.r7<6!UA܃1d87G֦۬ o2 {؈qCfKj #.ZyKl?>h[ Ir#!BvEțEYGI39'ۺr~z)K.V'&>yjXJx?"pR7QaօRllZE5>@4;˅k2?(J 50[ pλڂ׃„Zz, t]ʡR`%`eEVAv\HʋMs)`A^4.A@BI%֨MEIPIZwb4 xYO*qq7i1JxBtnEmcFʨrwi_j~ aqg'܁d{#őVtoJع_'t{3GZDs} M.ǎ<fQ_\16|Uuu?O >v+kvA> b`hЦO46C4{ͤ^27ή %~d/b ݡme}?,']=]DHEq."\gc`H,G$@@n1D빡F2OR{&MO.Y tl%NJm35=WɅ76@Vڂzv}]נ,լeX*ErX|_D׹sRS>= Ռ4.Kq8q0K۞ŸnC0([ :O}Cd 5IheKo7cD/((f:xV(2{@쓘w?nFC,=-\a|B3ܜ nF_]Et*MCX;HMlxuZHORPPtO7EUbW^gz Jc`LJs Ys- G;N<3=wueNхZdE'Wx/ wT p5\mgJ,A|wTkiXBAG(t %Z.t\), #H2iRLPmg1(DE!_#,y7 4qR)*̫Sx<sKQl`jvi r#~Pou7-+,uFB\$2ؗ VeHyC$BPg:X{zDr`&'sGߵ;e΂qs\6x`UۄaS5E+ EXupҵE#n꫄q [7&EM88ߎPţ3E KHIu?Uܡۿ)=~R{BIԌADπ7gYKՖ?ZX7|Ikm" 7urkR}Jҧm(n߈YKeynd7&&}[:սN>( j /͕jk^6gzų' "z]fZXKIdI aƣO;hx*3 Q/B𯏸$W EDAV={[_@7 cE|(3tfL׈2U{hݩ&y0@h) U j l`jk+lƁMJ !*E[# QТZsz&U_aEnDl:t dDۢT8oOW*= Iq PKRKTC{'0/s:Dr9kGFx!`HrR>b(H`0Y`ӡPpuȝߧ̄+9BK9dǸ`la Bϗa4 ,.F|'~ôS>Õۣad{=9aN3?0g'Rx]E+՘l"΅!؅B+UcrbAX:{ [QP?h-j! Ii iy<6drN-)N>7|`ł 0CrAؼ̛0'#^fё;"gBbEBяR)}#]ȥ˯b,YygrRd-9=f)7mVfPg"Ș;]9.^:cLc^=_/R@cǰ8^lYsiH$Rd]Vf0Ui1-2SCGH[:7Cyc[}8Qu 3>5|rC6#5eWڜt?ٱ8"X,o`Ѣ)5PTXۧf-"Ctc%I ;JrM>7""|"P 97 pӄTf H@$\Q'>BNA _ފ5ᆵܾ=i}0ҙE!rZmJs; :~BxI$J8AKi`cG(D1\9 NC. CvV' I 6|I cgX%Ч*~h%.]8SC)57v3ZYNVt1~3Zf+lA j剬2KQ0dCԨ(%9 41!y躼jdEY'!ep%RGIR4@>fFs= ψzA[DdU[o(61r:V-(Y[bl#*!]QjƮJ)BRD3:]#m!&U% s$,x7e!<'bL7^)5=WSUFh(qaR7t T-~^ _Nɭ ɿGvڛ)=ڳd\e4Ew?.=/@YjG9j=uI}i;SF:B~ɻvQ֦~ XhwV*ֵ="8"dnWuNWuɊ~&$:]aft]kpK L>Ec]}U!+^Α2 )Rk#\)+- ̹xl\15zIڹq"h i;{rcB@ACMK'A"[JKX[~Z`7FHPeܥL R%f.{5E:޴ƃ{MDW&V٩ԧq;gx\Q&XCfї,7W9jSLkI ì~7^TCǶnpXC⬬jN>gh\i>jy7p/CŮhWm1?_ :{ ].Ou@biBz5?k9sj/$(TX+l,&P.Pk;J.RZ{4؟g#eF%:A`F^.uH?n{ʜVdB\L/7ClXpgWGBbwfQF3֭}] C2D=0 +XMW\D'~2|Y"E\:'i~inpK#9[t{RYZFª*7U@ ;uNzЛ{#LtBAΜJjXPnRZ)[JIv\L>eOnY1!ڟ==@NO"cE}B:ls"£J`B~TQ;;uD6ǹF;;zeڌS' Z2H/XQbZ1L7w)9- L~&y}=t}: n9ҽBv$xZ&]X@NnV&_7l GSLVg46GïTs"s܍TQsg WϷqYs`iO ̬9]]x^S")t̃nkl$xH)-e%,[ K+&JJ)cV0&7Z@s7=K-U#! T]\Wp5L$"m3r#`[{ g$U4ppD*KFkIg+v]t=Kc(Jq5}I@v:tsEkm~3 -/f!A;ɰ["΄cYe_'hKӢW'WZ}Cp}`>-?2inek.u! lSxY ]Vg" ZK .*Z054iz5V3lY P,sۢQaYx#j#v6J8LgI~hvV7gc>qӉ&ة*><ɭ.!Sc:^ں]c6?|̨wmQJ0kb͸HqDizQ)wqO1u`+>2G'p@X|Gi+lhpg&sbaߞOC.e mg#9Zl'$d[ @e㆚cW"=iD4mUśltiIAce 葑Bq~t YoX4*i4nX-sz(/[C飪wHbqȝq`rMr@ 6>kSb393\6ReK'}8dW~C\PdC7sr)NgӺXRG\w,Yg.Yf͓Xw/̌ GfB6'-zۯ` 1t/K21qI X ͡_-A+?@)I>Iqʧ߸Ter|o`i{MD[gDm=!V<ޫ:h}yf&;2 ";3:ii\? ms6X}`IMOs@\B/٫5^""]~'rJhK@Ru־5.Fm|oN1^9<,ˬd pG1< " :ܫE UuK["g]Ρo .sE`uI ӫo)UB? (ˆzZwנ&)੥N?w7?9pIrVxikg]ig)҂"k#}@1j6t[>ewN՟S%,vDmg!K>eYn>? w/,^%Xx6&t$֊0O !+Ż YGIpP2F T$j*Z5L^׌iY^] H|Y_31u t ߤ^P O]dz6YR3Gc-B O\I rK?{%&t'CV9mbZ_j(~#lRο@Z8![ơՒ{6$) {u<{f`^U1nꜿ1iyD=RZUr"MA1K?w)Mj* J.l!:` n[0~l/zfCϢ]!}nd z5L:"C^ql7b`}'QZa 8]p^bDBy06X:Mnt ܈ f;rVؼ!imC*gE 'X zc99GQVZ̃i. #EӲKu!\=YYŸe rUCbW ko&57#&;zJQqIRȒ=ߛF9<sO/pn cBy0ER IڲP- t#,䫝=)65rT7[>2 |H%+ LR}%  To89A!.Yp"Xi%S_ˇ]hE8Σ<;5Z=| ۦ+,[˂foX9*M*^)888mkps9/o;sO=-ގ/mʟH i9$rfܨHvw\!O ?Y&Q6'DžV4W@ Ed>u[;))ܻծc,d86w%7jZeSK :Qdž2V? X=h&hQKb2l/IR8% @"y q8lC=/'-p3eIwJ߾ oqı LaM眎AIkf@,#N6ql<YP+뤲F"tY6|G(vr~ /慿SwJ<%ѥfw`u4DjR$;?"ti[Aq)EH?n~33sdDT}&DŽV+9"%6Mʆ 9]-KV0taҞ^ G4+JҍVծ x]$ٸ7?iBzAQ\\a0 &*e2d5Nfvmw` 08*)|}+H *lH!hi? ч{92C]3FnakxY1|0`*Je͏U+{$9g:#)vW* @ìj!-f!-#Oj H*ݴӋH55{ D=h h{5nW2U'֕5]C!4@ψ 5To®U?tO^1Qs' R;w.5X/q3Ł[hI#<1~^")4tja /QX 6Fk- +$80~F^0VW*adYQ$Ƣ_;f3natCV}/H\$! psBFL=rO Z=REi!W%&*vl(]r-$U_X3zEO-+m?M/uv7DKzC9]:?piƝz}7SpFӍr zH֪}GfO\܏$+̓k[}d=Ɵ媷twnDR'8 xS$a&iOqtJb^CI1`(?T^צ{%a/m#iRό%-t~+շ̜3]Vkqkc r,<6ڷ׼+,WŚhI @nBUO{MCOvPO tF|B#P-VB7zT i+UіF4yV6&cP|R8@Iw$̪yl=|SABw*H;Bq u˜ GܪYÁ|qCи]t_r_5.\M"G//uN3uֹS S"R~ 2 C\f B$x#nkm$5)uùLe;K!M{MAmyRo`&Io^Ljpכ\uo/Ni,`)U!)OVKBQJG>%I[Mn}Kff"ZFg?Q_5F!+ڨ8`HfǬ8,،?3Xq&F]ttbgᨮ7 mF딈/+0mSʇnC!h=U,EQ.C&ZhMk{Q{튍Z$ ﳡ}]6<䘕maߣ {WOwiڵ"V.C7:u]Wy E44)FDn2Sfe+RLRA~mC* psҠ ?o@d&3^tTb;`pyv)$g9ކ;*UgnMd2 0S 1Ԩu#<JTx v͗DzB~ȾfS^d5 =^\gO+\;:!@-SœLJ(SDXAXPݑ70JE¥YOC ,UV-K%hlC1θt>)p_-Ϧ ;eEybLX]4uL(:Y+Vz"Rh\x;"PD.GvM!i2Sn0Qv5 Iێx6S@>$ #zQ,J FՓ.3zWVyтmO{dG;_$pMo '6ۘ<Ψ?&Lg|)ezWrx )'A`zOx1 SÐ UUw㞋x|f'WA` yW|? kcw ]6z͋ԢPlN){.SJ3I'] mFW +6wҦmL>^r~xfx]fw}'ڣA2P\>6n}nOk=]=rtv NKFmi7nel29ndjƧDPj G#JZFu3)Z;eiC]ׯMIS*WoI;EC`F%v-ul;]&PdVk2n)S| 2 9W 0:aԓ 'űe}}H{RH$(xP&?Ƙ_DFZKg 슈237jQ縃 !Iy~ϱʘm!>]>ſKMDo_aGI~BuN>3^#УO чI( W UOn O'lTZu&{WPa@{.'ۋ= sN@\dq >!\otNm#q:"/;DQg+U_(sT#E+xGHlfnЭ?ecv 'PdYʠ d0`͉LY,ArLr!H]] ":DS2ꋠyR9nl{ߍ@ȱP8p"NrhH)]MQ鏲@=@y|MS 65=IZ 4$x*Sq6gB}2TmN\S>ٿ݄ 7\l3av$zNd>IL7B+Lg} 9(nX!N9y.}j")4 "b};j)W?fÒҶz$ӴB{vx w[F:tR^^ȎxoUr?bTEXM$5Mp1#5>nrKHܖ\ JXlBR[z&}e?ۓY$e u- xٓǣ r7')7fèv u{PFgFǀE9Pl|윍Y0(Hu%Mֹp`̪O>0 }~'= "k:gp7VKkYP^`9TIXNo^T ZfL|[y)|Ք̂֨?[K~8&Kݮ?dDȏyONjŗK[ԉk`峴B"`,Unb2yVfbe CwJw}Mq2C‘ i* ="qBà]֎e J#I%bc>c3T{+~,`@M*o]č=(Rv7ֆth`C3JNc}߭%eRu޲_G%X!|`bU)zv} l>g#5 4×XaHd AџQ]'m&Q?`ns ɣcml @)WّL+4 Vh#ϗ'5?TNgOt~/rܴla4n]p,QSgzDzmā1k*SI]2b?rB=1\n < D怳Sx(N ev^`}C/w "f*Pqn(ǨQETDJ۳aļ!;oSyk+00@O[`!60_qr^]Eȴ|kZ4D@S:P2^#ZB5Kd̶ӓ;јN rs#Au9N poRfz+q=@wRI*BnSzfOf D9PC%a>W`>@G_?>_lh CxgXmUŐ5 TߋALWQ(=GZ`rSwT n 4է0O4QK os6$oAgp; SX?!_e8uj(Ay:ɓYN# p|{?G4 xŋhqyT B&?ed5#ce`v[{\(.x#*Z?s>+fOa ˜{AOソI2J\<5F E2ݏ]e/LsWctGApx^<~ֽi=hw2[d#l4t׶TXƠ9Th[g*p6Gc:5hXQ-:v-o -G7|-l t&k-=yTny_Q?.Pruޝ Rj{w9H J@<>k) ?L ȞEE.l+kځAȱAg\Edzn~\ӬafY\_Sk`PyŽ(qiiggèg_eJJ́ɀEߜŎ.4сݶ&EZTO< ^GlZAqy@Dڥ/*rQr+{ s͓JF=hʛ]SYq|"fcE͝~@¨-1wj&CljܗQ٧ P6gC4n4Zq ֤f oklt!ՒKu PVKmS ٳοbEl/s< p8ca!7_ނL+^ўcZ+ x5WY&x#wޖCG?-h 5,[ 򭰶ȗc9VĽom}|b㪢osLАy! KNԎ*,]3 ȑ g>W.~0070 4Ka9eI"vmmbu#Ӄ"6 }Eˡi b$ӌS,(R=B[/aR}" b2fO ѵwLe: z`kV DPKckօ`Yu7&Jj|4l~.&'9 `;.ba 'Kd >jJ^-ZB1=1Gr SXyO@/itN=)2V?T*gKkz!h/cIC5{sP|?eo n\OIz^qm̾+تюy S9gVGԾr$_+:8|NS3G@}RMCw)o^n#đmLt!dpvbnJBĊ Gsh,Ch#E>(_;K$0G@[eUZƼs66TdXF¼UN_+& ڰhDLITg2ߔc{`혜T+C/S6yzU_]R̓zp"'WXbئ۽@-Qߪ#rgudQduut*!PB,P)?PdRkig@V' gX8>90O* XPCClش(mΉf>U 󼣲 9ҐqTf#K=b=v"nA6n']f>*"*{~Ug2lr '@s+e h]Uu n a0>)=mYDKj8kULvpivh4*/>"=vA1ѻz|X ^d2(7_gf!?ôFRfh.to87] ?n}`PDnTz)Q~&wW%*ŷ Y[ ON=ZS/xUO܂,6* 0~SU=,vh `PN ^zi2=v/Xry"ִ.*K*״5}N{iLp\ݨlȠk* Ha9EQ㠪ɄvSТ_RGk6ئ֝+v9s>iŠÅ^CɲJaRE奺@EFo߄Y{Ϧ5Dvc,|1n rxclF*`!T5tH2C _4t 2͟g?CIrMWUЂE`Lk⭀(<''X|~3Y:@b5#gPv9S1ZSUޞhX"pyuDl I }_V Gc13ͽV0 B!d+[v6`$D;!/85* ~}/8~ K|,>fN` %i*)lVTz ^Bw{: moSr$}rs\lG1htR@Q&2/g2#@95?>C{yoOWufqhetv+iˑ>~]\G y#dԉBXseаE,$sv:>by{}ZoiU!H&m5s?{yά[JpsK`lJ^ip: c"OJЈ[mّhnE-U/bHobg]"]o+yi8q_$(Lmͥ)HYz,>rA C)槺SV1P`_mU(H|^ҸIY`>l>Iܵ]qg^/֕I 78d e->'{(D==Ycw ]+hŎAOsW=D:κ{^ߛ"y("/nMVϦs?EGj.jJ9^3ּhrESU&~)II߆"V AC vw뫮:ޢ8k(CJblp8˗e#ǘm?+4ęB[bB*!<`/van(J2a&Keu?KTPSK:&ϐMQ4񐝘6})$aNf!t_&-So٣ϽsNtE⹀9+)F w|F #.~8xeLޘ-#R?lQ8`S+8mn%+rMBf{4O:zYS!Zi3t]XZrb#3YE\R I|'N)F"C;?r=*OT=Im0WvO +d܌U@!Dۑ2ZbFf$VzZɏw+!T3QxMfB$熞 *|/Amoބ'tʔs*z G+fGd iULipGQZ/_.vuH#.F_ 6r禱΍i]!!f,?5$Pre>oF,b{NWBY)-82y>? & *فiv\H#l7{@ݔ+@AzNn|2ޡu&D=xx(Z+=byJ;}aI@@ӻ6@ؗD#b=0o̐iTb@ekGT;J]VP/AVƾ}ha!(qj[g*BR~J~+($;{W.zX1ӈ\ܰ~&pT=X˻? %&TQd6)I WE!/f <WMx-dЌ8mNub4qTm'tA0u_%Uw3FO iۤ9'[Қz۽T+kGSMzWNh y 9 [4íN՝,' :̍˗>z'MoC@a%* ȳZay(6p`4/W( M@Դ%"ڝ7mp$bqSٹ߇7xK(D+vI ޱڬ"QX6i;SwPuH\X_ Szjѡ:\N41ca[0u-:#jd~WFLjCK;vOn'6ۜ@ZQKRSO@r" OP6Y *^78[29>PZcC3H+aepgdi_$&gPdUV2fq]" {rAzMHDvE+$}~a"6]:֦w`'7:j?yuά\>dS?N [,/Ef5xÜffuV})FK{^{ӭyeR ,'. :BF?3Q İ_A[Sd?mi6oLrs_Jčamj{&gK"ӎJ0fV6f./ |%͢.h6ͬ8Q@F+ޘd’7 pS:ǟhߪ߸f=[v%AM.PP f/&bnx߅/=2ǑSom_+}8y3}%MƑ5tW[ţM\snjxGRkKIM% 1d^l]&gpt@(99<ַK͝ڼ=0`mvV~> "#Cb@-*0Mtʊt:,;,Z( -ZO<쐠 /sa3ZK~ynOpBbWDZ_*{jl JNtaʟEpy4J/"rrC'3%i㟯4|m}4H yŖY2tҶt.Eך%?Z!(JXj>0H KY`̵Il $&s]s@^k&OVGÄ OŚ'%ڃS]r`ݖ;n=rU(OK 0L  X}DQŬa @R(W-|7ޘ@_ 3#;>Fmvd#Xd9P/$n%F&%=wC!ܪʼn׍:54b@pE3!Call!y>4ŌBm$?t*[ xУ djn,8Ve-uVI姳'WYaW)`EFTW\$b T yW+R=[,c!BU'\k|HDb* [@}!Rޜ^\[cwv |ubOе>\|;Jb^ c 7cs;WQ26l%,f2њiz 늃 swrX$CAT1:9-2x!D>\8W喌FVR2{B.P+ˢo}9dѬ?nܗtF.2N1N4AIGJǪ VPM(Q]MiR^ˊpG>5]'f{EEn(4yXw*}J`wM%p5ӧ9'RrxpEͭy5FWp*P`mϑڵFf~8?\x HD f741?=ē[ėM'I ǎV)FRn/qߵδ\GX9"KhB#no/j"W*<~,ud]l.mhsVG3a]*k闢;lJBHд^*mӕ˄K gGhSWju:^%֯tEAng G}vG]i.ږ Ph<٧4ݐ ! 7t ދ-j8=Q,+v*,.2#ΩF{D1XiS@K3b}j ؚڈ ڄpMEDL(HqRsJ6Ү?5R:wDL~U6GeJ75R|dŸ+\Mڢ3lJ\ziWCG=? èQ0Dt;wy|VdN.C[GP'fq>1mJ7EzWȳѡh;uCӕ_yb]+B׹NK|1pb g~&kjYvwE@1ōm\W]8h$߻rt/͹i%c`_'[L,"za֗x!h, B^'V'VI9`;WIA˕lz*9rtg)NY`7X˱^"qD ڹa1{ woWOdWZִۖvQ{3R+n[0G|*>Yxl̵Ωg7"[떫mbY輷cy}+ vP7jq-JR> M}PCY&g۞ ҌVӍlT'yVMI۹&aޢƆSUɻ!kGmu,+^ ' Wv8/.QW6tGP1Px3۾C(IMzsvVqrlEjqĥ 8ˀqO R'+m!As i<@&WFJ=2}R1rV",?1Gԝ笎RӠ7H֟ZJKC7 b keG(FIq$Ÿ9ix `uJO.odN #Cb\a*Pn>'hS; * H͈ Wuãf_uD#:pjݪOsB0:pW /swYw3ejAvھ>os;k4>ͮ&'LT4Hr' A~$;O\פ95ބ]:gVsouVkl 2~+.g;k9hd_ȟU_m`# "GJLF{*;֮fIq$ DK\$w7 a Ɠ/KɅGacv%X#>Hi:sb8efqaúWGVV 5ca*)Z0MM}Gy{C6>a9%O HbF-oܺ8L-c(Qk]Q2x644>>V"` N Cb|OYx\D>$n_`%gKP|Ms"bS`[ ፜7\JA9uy[AMH*}Hcz ž8 ecw @bȎwCMQߢ(57@Wk&!9𩨎rġ 3ȺA[Ќpg/IVϪ{ [7:$/IZVԭaxBuQ{¶?0;ZWoJ}z @N% fSh+;WN^r]sphUs@\GHbXۉI5LIL~wa5jCB8DDrX"oĺtA'шAHz~!=zsmQQL٥g*y})lH̲!Qd 'sp') rC0+GjMov2$h%Uybc~|~ߧns0Gm)`#[g}uI c/1߇o8>S] ujԿ:hTL].k ӈI򽓕,l) d]~xV{Sr];ju=KkR+iwO Kw5c#lғ@vP{}WhB$s~~mvC_3I|cj&7'S<{&aR"[vnPN',j=2; ܹ\3"eZa+wS bAZ Xu rپUIP\Ω@q ([]O4:: }z8b&P^!P%n4UY"D렁D9ay4d?"5%"tsЕnƀ&הa$'wBE,}tQHKX'URy)Att:fg`OF%e$ 8Ng%@}A~K}Lr?vrd>|':%MxCX؉SyJ 5+ک/eB6[(&bWf(Ap\`ifn% C' Ćz]Ԣ>|n\N ;8Nwu^(m]JYvV<+6ojT ,Ap!r>סAiZ~xKE5m?g ,CV'jd7m SВ o+LIY+#iX{W̔w銯-O@3ۂ^hzRA*B/D2䛑lhI"@oƫE!8/*z&7b:]Erw2êy:Nv)f$7Dd $eR] )M)ƨ%&R kuJ?ьЫu3auZE˝A0p$>GkЎpԡvPDƍz\3;6Ow xƋ_ȡ 4Pz3.`y" * 4 zJd0^'[Ic; n{CB GI\XkmKj6 #NQk d `+j`f>QoJm؎Hnl΀H&?=m\!5[w8AJ;d=u Zav<Ǥ҂) ,+~eEϲ@ltF'"&7 0t |> HVhx :s]*v24Ym)[M&1Os{N%Ũ?s5AvKߵ9X)j㪵at7ْS[ 2ʼn7=z3:`-[5n/Y:okYElL+tyHgIm6nS(b"v27ais"#Ry3 |+EHqWmp(E\@-7NùQI^F7ZA_A#PFA;wW@)\5:Sw#]^+xf ë};^Ǩ6ȇ3hͿ1# hCii0vа39!Jbuh L&d#ѣ6-!Htq}T&wd5>Ȇ:Ηn[ͪrSR-w>?uȳ9G#GM(Rm\J=<@U+h29cgrH5K3.(Z%277a'-Y<$KIÌFa4 8G蝾X|_JL\iVk\"]K#36c%ǣa%7U=6B$Zv.;mtǀ93a s )8G"Mh~=^lLhȻBO8$%8űW;weʟLv/-ҘwFqGF}wPp29 yd4Css6Ph@!%qZDg":mdSm=1yMswPV*0~_po@6%Ӧ,h{[vm߇.iJ[(DldPs%%HOQ`-O9ct mvnwu~54K0N. =F:g8Hu:HIhuΓBHs<$mO8Rm+|p8 n'9CPv/|L'8;Fpz븟Qq l Rk;wv<%4fޯBS.ZՄ!q KB;_jδCߖ^ԃ#uo )W9>+)h#klR}rPE ej 33Kj5{>CvAG;_uY{ ^͔F{v_Ҕx CgxDsmMqB:ڮZ\7ȿ:³Gwghy|]c>H%;kM{klIU?a˜#TFm# MPlfݚҗ Px6B\fS~Dd=god:hjR\f}&GP\nIc8c|]fL=FWJvHPրJ)?P:q p]3܆WDp<-G1uEJsrxc%'_"Vɲqsr% 5%@7x^QdbvƔ߭L8jCŴ zf {2lM0C(bd^+Y3 HDM P$=?ϊ5dbPKWWPQ=tEcd<.0Y͸fsRxQEt,dVFS^PGHws!brO{([@ >HxCN7(uWUc52ک[+)8sqHwqD"ڲoU)Ex5MV̲\Byx3Qo9 z8Gʁ>39`(ktl\Ucd ?&#VPqX {"*3_W~R),!DtG5R ƩU3H=|tO5!݆`Y7|!T6 *YNUH5emܟN~Rq wuh LjѩGzNz!H >cgIQgrjR[Va\ACVreS~5ڥxp<ⵗhK޽_ QC86?YK@k1N3w?&%vryƠ Re11l7 [S (#/)9y{4X0ST^ +?`Zbf} kkTOH] {Mݖ:8 ;3]S<驱] f}ձ&_kZ[Pu4 ߜ-?j /ƂXLh|(u33J( 4An"{-M zY׽>!EóGeOk`_mtr]6oTIkƒA&x4(rtx"Sŗ&4n7D۵Ync&e`*Yx0Jcb)%&cp/.P4U(g lԺRnƦ\eܧÞsFIQ^!'ߐI }ǹG SnPH*LgG>,3FC(u':).$?[ q\W"LWV9iMїIҽTsS6 aLוF7$W0oxs@ݾ}ɚY[ЕA?:r+vv/&V95T1+Q,u*kb>(B!6"3M]z|}E~;/M6Ո~,<(]zA sCK&\Ѣ8@fXwɋ14o Dr\),YA.%Bu.8u @թf@qV(ӗë4s׵|4Ay8KΌG!z";Dr0>@jpaX4w(K!:d-ݍh*(, yyWr~#r7>9?+67gndclfqQ=r\j!un6<` [*a4y/c: 錗%ZLC:oq *ZZO:82U;ٛEaw1X΅ FQEOsLˤQP v[1k =ǭFSVL~b!} o?{7l!ol$Bݥ{c2N;kI5l\[M!Pb 7EtKy3YZ@5EKblfQDÉpG!83xp3B=@`!A]Bu&o%CT)EIpcRڞ7ŷj=qiUvkCA-NWʁ΢&))sԃ^$u"62,nDT&U@4'lTae{f{ IDdk`sY"4 M(vulyzlM[WɮSʞSTA\0t@}@H^C$kؼm,XP$a@?#}b^ӲWfz!)ON^XcX IUWlةKyG$pGUTS316h"ʵuuV ʅx irF x498M7*fv({=_ \~D |', ݖV<佶F̄QܖI|n[LR摈:RjiBۃT -E+4'veAyI+t JE2Lv^za >7opuIa lLp6mYΓ'?|}LeG'^98 u)1_,qk@IЇQ--K`#*eY&LrR^T6)'J~Wȍ`RC]m?{jZBw^zcҐZ%qCKQ1U.6(@S *[B,24I<8k,"1" `H }z)B䶝in.&i11lh) }, H$tٿpu6_6nwh~͓sˬK{r>A*Ff87Lf1!)-J17lOYzg\bC iVzbN$ US~ɧFBYO JO>/_`(rxzC].3fL2oЉCh#ĵJWdePJ^Y8qVv$VYW'x" ˠlSYY]6E.ݦ6k!VҦҢNaXkd.I}SA4nK!Wt-iKYƍFCvS!M/<9M-gZx+׻x϶Ec~3=; ܩV1=.0ءUTe56ྐ_Jmہng6Z80MG*APT|g%Ha-嘾!!M^࣒.lG/Gcsy-oAr#LfQ|U1(0idešnF] *Ok-cFDv%gG0tLpײFDg4(i_RMPfJiS#I7}`ݾMJ&D)N{hQ v('ہ' k$-?5I8E!MMNFܺԟxۘpQ5@\ K;/el ^Ny;% If,wcpX. [=j` #UI?Z>!ҔjnF' )0L_̖4E(2vzp!Dz؈.3c/nл-eѤCAz٣9Ōj!40"TE :b% rL"*&[~{ۉbBOnű&;"Y;RȼL=qI} x 53d].10VؔCz"S T%IQMWm QL>*ֽ`B3"uw2 ,.dVg|iaTL2"js)j+eEi ?Y\:qY,qo!B!h\h;V{x*dJgCLWv` s}%TN@F}Z滨e0Pd/F o(d{Ǩ@b)#EHtx3ׂۮuscI˂?u؆;ɏBݵVҪLʤBpAHObªF7lSY}pWB{Ƶנ 4P~?3-5!EҸP[? C8^;QEM*)brOakA+Eh2#*xpA{JdXwa+)t$# fӨ6mD#wZib2S1󤚲a_&g $;DkIs6IdVt5vd(k{!溒׉o s7\~X2EJ[,s׺*0iE," %[ms(4"i>c@EDb*UgChA:{X/oc6mf7[O Ux=4 PMxeL?:xH%FEW*CQ^ f.HP#)&CdaS+po%imzuN#Ypթa,WHegdFW:)zͫ]O%-Sy5~Q7`~33,K><>{ߊSZPy •:o#BU{j%9Km>T0JYӣ5P60S(kNF0g -_63iofR!Fkg$'"xt0I2ig >)մmMDKV]l}o\,B,AxMV"wOH6 Q?˭ўQ/xEnK#)9)h$kϤ ^֐|.hfi 0%d;5v>$t==f hF7B sp{7 *|} 8a~0sw^m~Kb_Lw rc/w B}`pK#1UJBW|̹ҋ]AVAIEϿ`m"b \瘣&x|"Dr}!u6}ܧAǦUn(#/ rfmB직^"1co+ұq0Au4c e[0k4ζ*h?dH࡭IV]1uSvfi"pLz4bq%.Sx k,uV<} M6nȩPhn/edMdL>1jP|C=}{Mk(.am&Z@u ܭ"Rx=FI99?yJ$1ܗҝ]kdJWc0狜dmL99\~(vh)5Gzҫù69 kkn3ɛV8JRR3jw*OOgvPԢ54CZ '&$l"XhCǾK3rW'$fєlZB<+^fSFJnR"ŪD3{Zm\2U.8dYvxmn[Grё߾X8-&Ȩ) RҋθnVE&Y>OI`#$Ka*oQx?ITc>&mid|X'p1" [cL"$S/EX8 {Y&ϗK,,pH@H݅cjrx v 1a:u0*^}NkzkEYڐ/1{qO12#$Q$Y)+^;Փk]j/F;گ& YKS (|qj&H9f],mܱ[+$@7J b;w%( 8~^`hQ~C\^Jɢ{\YD ͻm/ `K!zN׬zNVG)[ɲN?Zsp/ۖ_,fAy_IM!  DC15 |k k~%#|u3 920 XXPXb|.hZz_I: pDK14 YETS hBbnyL[`_誋-`~.ق|T!@쓤rB-ug{ҩ_E݆x#//ڪ-EP|=Niw'B[X/] ˯y(FρG%mL Ɖ֕`^Օ Hss%Q#wLm)OX;NvmO`:]~h\ |$qxok|@-XKöiZO+JY(amQJ}\9 el Vœ B0trеQ?Bɔ^Ei6q'd~'ئKDzX"? [2 Ԍt0*|b3m}c Q|lԱL2RۅL]His,7%8z1%W˻2ׁa$J{ GTG/@KDlȥ?텯_w\.w /Zح cْ{9<7Bya_B6ЎO"U1ϵR6:|ɵ1]{BC&i;ޝ6|[ jM?!hWiK"Ө@`<CKG9|N@ xB ~  C탷 V^2j/Yz~~/]ʬѽ'3p?%7mX?֫Oq`!bT-dUwq,b}TstNyS)EqQ2%P i}YI})LZLU3#Cj;ԕ3H@w38fYl ̫Zocs EKZ&8"v2KlD"iEN3L#[tnہQTt"j~e@}z9:Чpԭ_<>HX3L5|%Lf#M3 ~9R߸Qjg0 *| <{B JHJjx /'O(Rr/:%|Y}R/RrZQЦc#p;9r¦WbpwG0*%&&;b`۷}-XG+3,:i 6y {.Bi:Uvž;mZNk' l #=Q'P!y53h&zushsfm!u[JwSG@9vب߈xhp X-r }Jxi o$h(iis+'a$cR?UeCI^_J3 ej*"7I 8JqBYL*t@[<~p&Be:f:%ɽ})L "$eq52?^tkc% ׺Rtȡ>Wu~ ݽӚ=Ԍ{[vQbȩ% T2HBUKLÁv;#{q2~ }b@nӭ'F;Zt [l1ˆ*;VaCϮ8Fy`/P| "  7ou.7JT OrmŬwve L?'<_D_8?f͎ oxE ʥإ  CJ1J*EP[_qg٭FkoְU`r`?j[yUν%b_`if%ø6 iO|L-n>nNf7E>4ҩNL*Y/cP%h~'"Q#~fx,kr7[<m-/6>P/5 _zR S$CܽehJJii90YfU^@㼷׼!zm2U}OfE4 Urs74i)J`+vPgR+שc fۀ|"kQk>BMo*r=5[RH{9 |SM>Kp V7#tJDrWJR*/A|C^ 4OM@4*ҎҾr#RWңY>~@h v'.j9dC&<1>jKbO|{! DCb->}F 66ߒ,flR_5g庂`d(#gŃ˅4[d-<r"zLŰ 6jL3E"gǑ ݅{9v>qY7pKq_UY(dKAմ\0amfP$DmeM8 D.Bp 2 y&Н%4"~+p~l/d\\_Jy))Xw9Pۍ\rU9W}='s`'J) }n"&+8S22K٫"x7`o0o_m,, fW}544SKZ@VޟAb6LyсJuL{ڷ;@3&;[a0j ڷKe}/ 4ߍ*擂z0K>gVE?Gg&rAqA)4t kBPq6<. ww(G5[ (`ϗGAyE ̐bOSV,hy_e? ̴h5P>'r*nבxX"X7D(@vs9%+$@ Ȓrd+7Pax~a7&qs)Bx((H vFv$d٧`6-mJt6[ $I|+s?yӨT[ XQΝ`r}k*iHl)KJ7=7|88h%U%v<1:t?31;U 82gOMRAWj/iŒgდIoRG8pa3:2vG)SV`gI k.ѩ aTvz;#4m[Bxwՠp3i'5]]6r^)"JU$*[*x=э3BV짃~r˙!j{1Ct)"I frNOsm۝"NE8s~3w@ʂMoQ2B u9W%z( FPqIBvhBu[{ȐЁx5CӋp80Ghذ0q7Va}O7l ] \X\";eKBX>%uMb-)C'Y?qQ`W]Ư9"gUBi|޽W.C QT<72r'rnZF5n4 ͓?@&,WHRd' Й mwof[wPꛃ(`DB̹ )Pۗ>|Em,ͦ[kZQj f(3#-zTURyJm Q$\Wgb  6t ~NN;UU͢~iUjm(}6ͳ5:Rfa>g;${HzOw?!AE@?рV-=ʺE?RϾ(o*V뒪A E9A+o0-QI[D+BMA8cF:oH:#:rQrrallUmCږ`ࢣ?,-4 y$8;)`U]EWZn #bk! $Կ85[ӌQ(61 ջҟQ4C$˒K.$CrZ @=Ǩ߶,<5Pju7W}U8P^͞5jw\ȓY)+)8nX0<A1`1ĜUr$)=Sr?bSӭē{m1 =$:M }c?#p,e'+]G3ڈP`ܶ)ϩoɏB; e1bpn͡YHέgY {(4ݜ:/J>BmG$hH_L#z]R{&0v?eZƊ5E]ؾxNHQ"gq<.`Siv IfXBӘPP|Hˆ ӻ9אy\%2yIbl.B>V#9L4abozDF~y_5ǎND?D~M+UCjkrZ6 ;-&MF(b[+;pKdK A~#LtM*4+2bvI#ښT'v?WhW$S!N+i+"%$g)':R4ˈF0F- (DӌΝT*x{q.@< r+32@5|Lj0T? 5`[s_9*.e}wh,2Whn} Ɵw $>cm/=lTnPU7S#vR@u pQ 3U|nMv )Z~RoG[W65v >X:w'rUnqp4d,< PH 3eѿ([̼L'>a9/lWUqtFOJ^vC뺭bL*?Zh.`X & Q߾!Pģ}9wP$ݏO*C$:jh7#HCɕ TyT-/#^qgg CT^SXEqױ9, nP]I&8ySӱ{{j9u1~=@ -Ը^c2 z+7HC–m/`f`^0 *" ydjW~n,25m{qm5d&iSE~o|כG`^u`T:FL'>l֠aNZ[$n)d 2i0~`5-$Dϒhvk婫L~7g ^*t4dl䎶2's_9S0cf>!ll  6٣99䎕,>'6[-Β1.>l;]~yDѝ`oڽ?ueSMZ&],Vr6-BWd(@R}_5t r ɌO5- fvXƤ1bƹD P-O_^ƻxX( .T0vK0A#`Y|ݰaK5׈䲖/.VjY"U L^XCմV&r=g>gtLEwc1D/Ծ܏lYp(n@.. p\q$pB*3]C ՁƜ;XYgr>&@H4LF/gRm'|3BNmR2+N6Ҳ'Hm@7^YpR-' LD}R1sWos upRarMARYLe¶GO)`9Wԋ̪ˤ#fNaӞJpī]"D Tx%_}9Ƿ:IiUR\C;#Ξ1VTY)$*^m㏴SyFsS\p6h◵V7uRgJ3k9?3J+ V7o:TH*!6gFK(ԡNR}6Vbӹ~ZLJ ScSfil GGg:ZpK Rf i,`slgk=S|~,-yhȢ#܁#7yc"K|GbO܁|H}b9e9d^B$E9&O8 Eo[2<\F%|*Rf麂WFcx>HO6kLڰP0gR"—:b&H&wU~SϲyjS-]^Bꅉ* ؘ̢c){ֳUop8iwBSb) L)O5L8$[݆ZGqy~)>?HV,]d?zZa!KsFI.M^OGiuLa&u'>mlPR1^cxbGZ >Ed&7P=O5 Y[ lɣ;ҙWP_c+pGܠb6=rpqA6oZd=YM[!2n+hm&lH # ('ѯdW;nZE|$!v@D뙂(^RP8p 65!̞UNk 6[@OxpBy fnZr*w݃r'|*TqtΥ7/ꘖ|BG*eF9YHFprLHD5JyAs[ΙHWXɘNT qEDz+ɮ[Qѩe9V~ZZnГȆ. -qM?Gܓ"Q~aͿZBbΖq 3I&kL|qtFI1Z"5`PRF!QdnO[ cۓ̓FGֺkϱ,(4@C0eca /IJew+s/>#Ri; F728 \?C22{iWP>_rv%mHx7[X/T1%ѦVSD_uAv֨$xjةB*,:+[6DžoyI@*>t2¦Ƈ=Nl?BR;ZL=P_$0tL o7]|hE^׌wTs,P6Ye8zw؞﯅iЁܼ=ۙ{:0{Jႝq6-6 U"հ|9W҇R{l@[fUVk,HƔ&~w$/LIKcr fu[>W7ZKtu7=`%BhGW'Ve=´Z9"`= MΆ ~K1>}?Z~QxR#NW2(pStz̳'^(t?4K ~IQSކZ\5cRY9h 3F[7 h ֽɀj:v4=x+F(Pf& *epDC6Cv,(wiĐvJdu/5fYWcS;cq0GkRM]cӋ*Cz!LKW$-~:n= gm#HTmp{b"7v;45&Rq4@*UxW'Еe>S+DZC&;90䐜ZNo˩V+cϝsRb:~[WM)C@fiq7g6&+R ԬJy0 :|eaجWhOBSa]j}IT )AI6 ?e'>`Qs=+ εq}TBRTwd#pd(˵Hh5:0QÕIpWzE*rK^F\о˓"6`q*,;2uV R 1"h@\y~¼Չtcvh$)H TA9O 6DPk3-Re&.LC9#m6Ma =Зee:yAX>s_Ot ~&*ӶeTŎ_(l*÷zQ5e / k՞Pֈix{:ݚI›4`eV^M7~ZO }10=z*6~ֳ,w K}N?̛.5}w<@Nr|``zr4Kb@o0;N?G]^Uw4TpR.OȨʏƤ_ jvA&w|E|FЭ -%bgZ5SOba_u{Qe<B˕^q#,Ldqٗ֨E@$SIPww yB%LԈz9.BsBዻ`>ȈI0kmXjb'zڶfq%>`W39H魺X;t? `f#fn;j?D&*-HpML1Tʊd9ٓ r XX*.NEٯA$?ͺ$7gipןN{. 3b MS}Jϥ~462v.':V8<<_$/ Ӌ-~DA/RR$w^Dž_ Ǭ~id mkEd} دL ^woB>bmv5G)"O:-69ѲOlQXŠN奾1X7bV[Gܸr3VbQ/ᩩ2{;H朰^9%}\XK!(zoMA5WW2C:']),9efT0> >\E]iv.qrϠ.7FmV~Gt daĎS8 c~ăW Dp^O(Qx:$;PQdPb-d6;kKD h-%xш|F2 &myb [GT#>\l `?Hbb^"p) hqO]NvN͔W( ((GִMsT;~5_k?4z笺y4{(3yc" "W'Wk 1mVwx_"40? SeߥVjƍ<(BolL hkO2uF!d߿@_xo %̚"%+ H%[*K;nB)*$V`V(9ꔠoB ߆\Lr1}`*[e&.e ΣA_~#rӹdR)R+MGdE>kDCGd9EV bBFDDUI7Gs^xt& aCÒaF׷X GKSozn>-a)H:=p2YNg# ̀vDlT׆ޏyN 񄷪 Wny~._@&ϢI|D$:::%#YbdRg,;5tOy[ZIo g^V \hl{;$Qj5r)\w)VL |CI!g92!Aѱ]sIӣ4oWHQ@'ɒN|ۛ=#H#e+e~JR7r,z\|wހʨ:sՠXzPZ\sfĘ-a5vAa_ձ9)bU`;걃);3Uwu802 **U *gIfT@Yf%8 ~q. yc&L36΢yzS딽SwRFd@k&L'6IĽiry7eU@1BZ;ϝR+yQeIҫ_sư/GeXVlp`iYJ>gs>5td̾w!eQ BϠTEeA/^`,"`J'k BXeSz$ITNQB:4,<'8:17<)SřQꝗ~ 19,0:Pp1t%g[gq 0'JEt@;=xaM8%܅D&L>Y{7V|N~ɠg[c(2 dHZW'҉ѳAtTί="cJ^ oo$rWG n߆CDvfhc Ӻa8١BG2:W{ǚS]uW!6ιD+' \6JJfb=h'c/[![:Y5Oc.(4/@l'B.e5u͍"}*-Al Nac]ggoIH!5}_d¡;v#ǔJ#8<0diz{lCExHmCK7ugZʽ#cwC7 }$ad}3_&ōBJAEAu<l/…{oD^T.㇤Sw;lf _6 #B6} rx:. |bG7",ȟYOVh`ep3}H)\3I8k@O4u8xTkG0yJ<^$ыө& v{tYqT5|0kçH-dC?MXܿF[,+szn-$m=w"2GFuy=hj.wrukDQ 8y%veYɭ[ % fD)Q06 YhP$q T/3嘆*=RSd!{efG y1)`1~(\,hܟjeF1Rmѝ zuitO&3({UkIYydgUή; `q3$[CCCQO'PHϑ48:˩y!p:T)-=CRc9@[T(\L%_дկM@3}cFЬs8qv-vdɑmSP^$Mh[7kѧo\$@SB+@{Nz97b ?8OR~M\2PyWv$}kX,N,"w ۈ]ŋC)C vN rЅOd.TW+XӐ+z,'>ɗFq"bmRу%~ ZH~<ak([` I=%`@ZPPrRU (x_c 7RW\qMk{p}6i5NJ{C؝X6>s7譽T;-3n'"z.Lwt|x^VJ:x`^W\%HX:0~%J>N[ *Oc1aEh^j0INWUh͛fz _EJV9^`e4 ᶽJn)&H(v+.3<@ 'JC,_.;(4)]~; Z@bˑ|˴{3 cO1:FP"`Pc䭧]_|=c" ;W&\2-P֠]MbB T})w|oAL=C'<ЉuU]m;;L0ԽU{Iho I$A{T^}+1 9\})A}橬ct`Ctg8" gϖ-^Dci$}QW]¬qtr%&x-_Ґpri%cC耒m,VP$\mٲ|/(b½".0]>BO[o(R%e |-茋kYl#Lk!! -('槞^0ڠ|ҷlVj?gH_!UűC\x,zzWw+F:+wV6TM!òJ;M`uI$yI"JC+ɐHL uf3x4Azd1T9Wb rzc:@X9 O{ykN}qs& /1.'o ^q:=-i'_O do/&AX:u'fS*]R$,%ԦCx{5i1nx4o6 ʋ՞N#o~/E+ZQ:݌_%uRsz=jL[fX[Sp r;O* bV<{ !ki4Z6 {EAuDOf&@9|/.;*A{UȩYwL-ZOԹ/dcmٸSF3"X%fb6O'rz'WsD+!x9gjG/ŻY(ۚʛ06A08ƋC6qO!X4v1)5*kVyxꍗ8IzذB]r}7&a+̳d*3!*mΊnV$#w! k xb(O5<\N`-"HiǶ VMH.l&qF #eE9dF$_^ }5>3_L}7}hkchzƾzW?M[pt6m/Q1I((<xjme晜4ꅦ{iA[ kܜݪ~`[I P' lw=P$Ѯưdȿ|54&y ] ձ?n.oW_xdx8A{^v ;jh>٫>-Zaq\W aǺV eUvG|f o^A  $s`Ն}L(I,j#2[  6wAHqŢunK&Z팜HbL!tYm]&$X >r^rtm ]?Y\+N/lYQFL00l̉1"I=!h6e_hYyzYCCڛjYJ`2MO 1 Vú 1!{|Ĭ0XV| Z76.l|9.:6b,)Q s dIO} o{Й[tvEZ-׷AXy -s{t9?fǥ5",Kߵ 55ŞL*v5X,UdʛKB4qħr(m Nl>)oIρF)iVFD/?ؾCXҳjShs+uKQ0hZX kNSϛUqBѐA$>J,Lw鶇pM9k ϵ: ې4S7wZ(/A[洞2G@?ߔZžYNg?gfdqqϬ`liZrG'I9pZw64lRIN;$IS]|ep@6a?Jw(/i/T|A,brVAEHz2)"O8j$T䁟EEqďu]ha1jq }<6v$i" P;sє⤮ip OO[ +1$y@PV%&d*w܏ڽUɍi5cH1"ˇUi/AQe>uQw07Jum v:g4{tkZ "@ v!CYb%`Jƌy(Uu*uxy 0 d)`yމnF#p\,Ď|)XnZ ,;ߓ?Wi7oN+<,6:u10#z( % ;(*f)$ˆ[e׳:Ur/ϓs|vg#0}m͆.|<; B9h<3~)7g?@HQn}6`G!`hcUp ESm"ΌL@?CQInʎΘk`MLMtjT=ْow/gUNN[ /W;'"}@g[g(BE!{σ)kE#wE-N4daBƇ:6 \:_iݭę::)rS]Lu/Jmާx|۪V>ڃ'\ 3A'4%&͚(̀v3ь/b?r>yqݎn:6R3:$iAыyQ &nZƔjVik1bs[(]nt޽2#6D)f&S}'µ5[.hB//֩]LIfz@βaEj_ChSWd1J>ݳgŰ`dH"UZdV} €9J2zq-,SJg_n:[ˈY?ٞ:r fvƴj0=_vӃ:Rg&*\~3içpunPؖX>"oleMJzɏ1"n]ة[2.>SIcߝd1$l_vX#2Z+&) \:$>]Ký ,7opDCY;-- ~Mɾ`# >Qk%ͧ8UЮq^㵱41CE^TSw؁Cv(uҀ= E"T,=5 'Tlp+ )eF3@NQ.^5Kf r bh&b\Q:c0M i{j@ƋvZ\`6/n؝duچ P$Fߪi?H81>{7~QiR.uZ%q( :2z{cq(ZN)_\? ը_`fS>+R\%PW'p<1h~Ȓ4lغ0;=geg7l0W!<;+:<=l՞H?n(Z;@X\wWomnWkǾ<N ܃LPE\ trFт<Уf-e V#v,K@vs X7W4cQ5,T Z/_{IQ#,l mf=NtXJVnOے =g ä>H;k=NKA q(nM$E ``F׃?Ej.nHu ȕD%58q k.e0 J'itqPKJ.O)=d@U6]X,xTvg%FG~ B.F]0bsדQS{욆ץz3Ϡ/~\H };mqH\Twm($ݍh~9Y٩BA&;dt׸5ԓZVU}PA{pY"0.z>aϦCw9YVd\0-).ntO`]g\Sh;(X6FLUC]yni{8S&Pɉ"+J:k+X}T֨wF*]x^g%`^ȢA7.){&p3#8țF; FAqڳG)ҧX_ԣʣ) ̎ElOg}djW>-`CȄ.jҿWuЏfeGo/:l1t"Q:t5a ep cGFy8<!=BEE󁖱IOglĚ̩]|sZQ5irf>BF`9r[h_04!NwaKsq)(Q~E/4IUtQDYLakO1 ]Ϝ0#ecCp Vٯ9Ѻm"n}ゃb.8CdRaR*OIv8(@"]Wy6_مO腾CvoVШм|]]-o] h\ D)85@(-Gr,jp}xn?}J%q+tr>"VbNٰ{9lBN u?αBQ<(RcRqB2κ<kbp9G}\rmU}>cuVjZwRX4fik8 <*ST{gU35,."δ26ӷۈK=%?&O6ϧy^ PVNu8y? Gr^h#钄aվ{!_k2BѲ.}V1:fH'Bcq "7, 95rM~ <1zNipG WXŨzZ/ca@ǰgv\Tf@H{;xy TٸSI|swtqˬ{(@)gɑ[M=_&>U_hWq݂}0X%T @A.kQ́$1?>*Fb^p@/NRʥSbFn` 67Zޘ-k;+Ye&MQWFju{Tqs軶Xj:n#HBmA>+CRuYN?&4yyI=Y{? ~0G&l $Hv_B Tk I02X[z0ƚy` 6U$[قL*g?]槨^}0,)8EtB5o5hb ݙBUj%Wo#a:-uU|vv`2~ n^H`>#X4)}=o|hI\Z}t!Lm0p7 C ;=ߦXaP ;J :cgFQNmq:Ch+&0zf"q 7D~qԤ;UGNk\,Z}WǷml8;+A?׹Vcr2Mh,lC,t&cߧ1ȑbwql3= ?`زJH$rloYE:&kțlWUTR-M]Л7px 9ݍf^{1A.GK,0[4BwKA8H=Hw0 Z+zaLކN2~q2cMt΁Ƿld[Zj U\_anӮLg= è b,;Tq?*r,loe{x-ո0"|^s0l?}Y Pm}<1U"ޛ,~DAْ]`C0P-LNn^nzZ$಩2~牅r~+j{5_Q@%$)cؘ5˙gҕ-ZE׷Q<ՙ ZFwE!筯,/\5"ePd'0!li4O8}gXD䫭DګRQ%hΕ>{>1j⍒$!U?3EzoH;8?$#*( f9Aŋ(_y.e;<~loǥ7<<佷){:a}4 { @֥<906O\/Ve8ބjnmxX,bVM6(kE0K]?imQB1Jn9ՓܑB5y!:褗R OS G-kX:-PvyauSy ' D]1քz9ϝ^ x{`-/$Ȯ1W|G\ˢ R;/YG{3;FXOV,i{|8?Ep+HMwr>K3TQa+送 #ܦ` |Y늠ȿ. 1RgBJs# Fj\wWl+˿P@@|1gB o|c6UW;t )6zˌ_w~Y15#6U6ѹOYT村m/α̥$sK-P8^q5*?–fzHrPϘ|$ecx<6lkG$:7$]8T̐|R@ُȄ$Q2Aɪc)RYNMr T8bG wˌ"ҰyQT rvMѩk7m&yx+(.$w_5{(!)v'#=ل5Z*PKJ]^^;7t4/E3-6M~̳IhAXIdsr:pGPp᪐R!H_cL) gm07 Yk ޲ i! [رs RrB!$RG=9>}f ~5źR ,à"01a<D?o O&*ǏhQa6 @(:Oم4p %@p@{n8xr?Qy!^A*~o+ZR%"[Dd{agF v&)ciTѕNFvOrw@^44lCګM 5}ʇ,@N@OYa.Zy#TL\ 9 F>+/ !n{hrMn}JP)] 1;q!WW"U@5$M|ք3Ӆט,/whӮ-ȡb8w{>d&4Hn(&Js QUb,G~Ng42 ÉsCMæ?kf|P` yh.0oJaxB6&'ӡ]ɸEI%j'o#1-TTNHowq߂J%⟥*D(Iy\-J+j1c~"UINґ[4dij^hׄ 8 \بȕ엀|iѻt z'il90#5~Ĵ枆ˮyDb阽 d oh]e;ɠ^F9OEB Ca2wtA:?Db \SL"gެUlyQRɕsR$D9ߕE5!Ĭd_7  _K'nV֢&Z0j-.c +jַ"(a(t]`;L"YلLEUf~TՇ]gmvi7 O9xa}:䯺/O|8A ?B&+a^b;"iZ.lEc" oJ Nq<\O5H`%0JҒK1ğ8Sh 9Gz֖yE/ȴa-#ҏG'$3߁QH5$8 v@A¹4 |l _Cl;~>5SifľLYduH?/<>7&˾:Q9MvG S!o˯۲Y@h ԓHt$)[Ujr E:H>>tk"va%hhz.)xA}Guk˲<"X"2Sq4g^lcGƃQOaASO<奴?SJIK5f+ERhԺ۷ӷ PQǼޣb *`mEBJ7.G9V*A,Ǝr3k Q<ͧ_=ƥLdЮD݌ :b3jQ$Az[0~5>PG}̂5W;=z¯m[H A?h z7!a ¬Ԣa=mvwʅdXWѐs"('Ι֩NjfT5(GPRQodilb`EjtF\a+؟F, W_ ?p&]xF IGy 9n@]o5a-L懸f~DžVHP5 > Pr˹c-\BװK`8Ճ6Uy v_(--t͏ a? D`DM3 F8'L"Zwא3@`&HZ*i~\ \1x^>(́8=U!p,DGQ))?V)-f)y%.嶨_sq-7,AgR-fsdMy"( %uFT֧S2 0M@!Bή&я-G@hWi *AeqVD*5pNÎ&>nRHx7 ~#}JXc{3u,HE$#\7vnm(Ge?# >jq2ɬ뜤6P xҔ%Txcݞ+F%uWV!sK(&n\"`I-hR&|zݒ>Tpw})82/ ¸ , Z8e5 ]䧣 ےCY Aʳ[xnO>Js گoҠ,!軆r}>OdBe3d^&K /kΊJ2A]gRk6 ,nqIW ?T]%1 _Ptߩ[nipjgIWw!G+jxމ ~#Ax-T&u`R O`0{Axޏ, v~XP\'`хUb0˞TF9/XyLaP tQݢLueBuOiRs~-J VP&9q> :әXV&٨~t7c3V;8ٹfl[˗G/dfyWꉛ&aiB5W2B{]l(ĸB`Ѫ+ -6]r(N(b+aebs<ʏV+юÍu{8BhRٔԷ2i6Dx,`&~]٨GCH/ҽ(@ ռ4B:{ VdiXG$x3k1v](tMNl8-QXQ.&aDrF\_O?3 :INX60X:4\[;Z_0m A]'ޝE"t[A%"m7YͰ'``d~Owʋ}_zƇyV_׽YU%;zg*sL'CDj`VΩgIrǽU2H[ȖظT8`C.-{ȷ%(&٦!,Es*6Tnե{7 H9^/%ײp0 |Cz]Pj@ytBn& [+fxOv DxWWvƶ/r;DӸL*KsFaOݑy{jٲIATB>>=dv#HAhjXd|35PQJurTsQq=wPwE+V{ Z [1Yԑ)57k vڢgKZ#f>+0KNSqT 4N,.=BvYB$џz'c/eepWmxىvԆQs7B \Okz^ahZkXZT^8څ@2IJ ayjޜ7* v&d ;RGsdUpBpP½xW[`6]7a|]VQ| "`Z1'^ ے%ԈvnHglUp6XWߣVCjܮDQakP991ȿEc+=/O^ҹw_lRRfAIˬm?9?q+O{{r mL@1~•Ee? $i]6EHC:c7=`ݡYڑˉT|&J¦8-i1 PJ]`FUim[N9$ Ti3=VqU߹*XjƢlqS( R%"VR] ~}`<'H,l  {MKTG5ץ=YTZJ%e aֺ2UrPWF:$~$iެg0g Yi!5},@ G!B,A?~J,%. _`2r,.MRlH"ƜM秲Զͥ 5|h)nj[ U=Ǔ UwqCǐWj;kU{ŝ3'ʻWGNOgvE}sOM'>GA's' 5$T[Jtք8hK7{(89Pziz>a@n,)Ăr\=,gl*j6ݺH։ c @]u_/BOǫ"lK 5`7O@E2 [ےJ?kO)yτ>4{ܨ8sT (:@!/6si1eioB@'GepRoPmw'r|TuwvTrH_*5NAlIU>aЎMB 66pu^rJvj D4JNQ,,WxPiBMMaAn}q@g&x'|egƘJqY[,o/S6e2^xLV f sẀt:@O\vZ'u &y~K+Ȣ% ܹ]}K$nq|=?Q}>rb}ZH$j#1_.7LhIS9٬#D1s8{Ncr}y챥iHә]zڕ[EkWKtorϮ2m  I2̹ Jo臻=o \]8Bv0bQwbXk fa)4p6=cۂƁ8X|NrtnbbyޠfXZXzj%~qL,iU67rAf3\8f&d|h.v.3Ey,YFɺ`%t{$T5@EMn6mcbcb @zY\iGZ&6-Vʺ߾ov *9,Wg0hžl1vui+ ШmH \H'$p0Ł;̥}@7XI)TYHlJ ٽ?PjW\)!)|"R cwQ'sțjmZ jʩid^ߑ2~m^ٻ5@%p\&pC ^Ylorl7bZGddt &ݦPZU eyՑ*만Y\}4w"F84*NI}F [MXd5g sE红^sH?z%%~%# yjfRBot՝\PJ}22(2vÅGP5j.6>(%Aevno 4|<+CÌ*[ .w85.Q wn/^ ga+t4"Gɦ12~/ClS>LFJYi[ _i8j |Ct x;>KC̳g)FZF_BgL`oV'iNbƓSxS,Jk!oݻ:ř

P&Ƚ)x:܎>@:?F"×gBV|ɸ6W-A]z-o􅄦MyV}{M얎ZcfM58<=~':wdܵ}%.9*-@瀢og2s ;(rCA$Q^A5Df*k *]XOWAB؍wTWWDWS8omy21yIhHΫދ&¢/.y^p 5ԅhv^/ 0XL@|C'g]qIS+h'n'Tvg?1ǡ &mBk[)Bf=36[&;^g謁elѳ} eٜ>1.}ുO$u{d4 Fd8nH2u=hN/1QNU4@g³gw،Eeꮏߟ@o~(P&s%o0^ZHsXk0,ɰ"li0d+|nݏݙ!(YNBo͠wUMиBSB @{}Q7"cE1͡ ڈtd^ځGBd,H(RDyLy`awBzm]+FCε}A MKVbͩsJH Y~̶  ` b ;dY҃ҹ Is"n54ljzt/VX C8"EbtOJaam$ xq]TU 'f;Krn=鐑E2Kګ!T»T{xj9?Ĕ^m[6o![\E 9tD./9Ph6=M o~1!үI-u/W Mj7ZRVcrZ$ ~D]vdcfa2\<[SQѵw@ϳb#k ֒mn~w6 Us pA@q=d@v!Q _xFHRG[-?+PLn<ʋ=ɮl-bڔH)/ J wΥG5sJpŻ1O&fPV^23r\J5BU*Te&5iT+^0̡tsםr~GMN2&(kno[%уNLF#J(,iKX rFc-6xe ,<4IgsDd$|d'w)k5 CVד8XlE<Eѣ NID\YO͡hΟYg@R/Nh 1j̤ӎeD]`O1۹F dIX b(T{[άҭӝJOi0^`=j}3Yt^?@"ڊJQiC6ɩrb;8IldK0p'> RJPVYt=TH7 ˚C:Ԫ(1Qcg-,K!(_^|C :N* b}q +x*;a ;t?=`+|$@5*9SP8?CT.+Ӡ]>!w>Cy$T$Af_u_6ؤFoڀK)j5P:N.j+{ ܐ(YYJԯ9JLOCHXpeBa^,忍XwlǼP/򲚰Gq}D{+!U#/Ca\EE> {@zl?O ԩ9CSͣ~2NRwЯ؛bDx&[n.e@+)jkz?$׳v7 O:9lmrswd_-L@RW#M%Ͷ2cf|V@ $pZ P2){HAs:نѽboTOPsUD6uICAhc_][yկSo%",a^{W׆ Z%c{cBZzL6F!x{ECgv;n#mrA ʤ#bO.Dn$Y}JK/ ˡsJk0Ã, ]Wvf3PO?S젶3b]v1n[=@nGf loP/M~A"ΒAnC%ڿ7bג&@q]IIm!{]=u/8 Sݑ,P;u$Kϥ-DcٍyJ_Bމo"xmm b4Y o =߯sj טw9I~շ_fғ鑱Ǭ8xzu=|9q]aNbu?0xG=wY>5^81b3g(󙳋נ1wsV$1~\ۯ!Tw,B).+^ >]ʠFɭh`D_,ԟnRl9C{L#Noal>;Kc lU)JD(W{ͿX9owV5܀%}бuVʝ4Ȍ]~yvÓ(zFF8g_*V4Dnr#!_Wsme\b&P/Sx{-G6p '"Н ^@9lq-AH)$bѣUsêda6oI0&{k-SdIVLBm0_/LtYYZ`T|HwcĨj`6ZyOe mlE΂Dj=!u?'MՓT ;h'ۢБr u!W%-\ya8!b9KѨ%=\fȂ`cN<^3}D i¡|fe d~vw{NJ%,@k),GAAwvi,\eD_I_/Rf.;S+rl|* dڒfrf<(Y}͛ϵr@T:$uU銋P* sm/y1ñHL6qxʩ1C¤DENtďݼSA5č_g\ꐚDV\O b6*ERUw Net>q_bktkDdhVT\mgs/٢țՅ@uarB)[T1AxTz ì%%1WԺ*zT"AvS"x߸+$/4ހ?j6Z_ :״hBBTI4@Ce9ƣK@\C݁}$1&5ZeAGt+ wn[㞔x.)w +bmJzGP:硧 -}GC^WG6AEɋj2&Jt酦53RI|jw ɕ7zCJ*cTiRsm3FHI&Jx|!rS#-2(&Ԅe7 (ݵ|t)hzHHޱ[5XA Mj9R$>^IDj UcųtT*.q,Rt'M@*l",FIjk\&՗bo<L7|PH@ f|ZYf.}SܐW!.EU*5QƈGʅt(KFMgoUQ+zdj]Vmur<3b׶-C6+*֌c:b29Z!|-2AD[qZ\BȍE.(pO7p`$l2S_/L x7 " c21#-0SG46;5ʣGBV}3XoXu6/P=Cԧ*s@]iJ_޺Lb[ҋx&pG3f(Dt*aE/zr Uer}W5$ z&BCu4EP>HHK=m&=C UuxƅzIϲO.$b|?hVXn예jK0 |Wf'iH²\mA9>Ŭ6Ǩ=iBČr=շ^2YSI~)cdhBQSv҉JڿcX~CoHKgCmkUJX++\Cyd$r^1qkNl<ē?\MK+ o]4`@zxK*qQ6ny T L!bzGի¬U}0f?䏼/o)?TP')/MlH}}"x)4UeƌSy|?7;dh$i{̱v$oP2szhIXH,d X TM;Op+.יI[fȌp.MB1 ze۠{i_e#/8{vF=o23EQNz 4{'B Gpcyt?ri3 hKFSFPHҖ + aN?aUrjPw/PW5 8u 9(f85_z?zRT+"HhH4MJ}'$7VUȨ1ҝjr3T @Es1]vx{Jyazߜ%d1 gתX? >'v_BuVk 7V&tB~Jpy823h?zyP`/`Q>7[D|*/<9~ ǑO+}I"BUゎ] .iyy@aXqH ~w p|9kd[2oX@b[DX /Z {.F K|#m0H)'Z;v2U S;|˒˹ڐA>+gǤDr Y\\s[/S~IAy]ʈ敵LpWhij;X23|ZetqCs0ڮ81io0F-xHMnz2?0q~x8|7Q46S)~68.uk ^ J8Q>24*h@MHQKVT*7XY+\f 1ZۯSÍY}~ S9Eʲcn%ݓLu33sElہ0PF:^U?l&Y5_0}PuֹUʑ5~ {X,0=DO4#,+(CszՌ(枈K۹j _Pcu"P-Aه77Aab} jOފ#*(Na UwKWbR7\V-fѵt\l?l|<:7\~>oBC/;,q W<ݻ5ް<ˤ!By]2>,tx䃲xy)6i\!Hr&ՙہk"JdؖlFq6 %-ڮRg2 J`̂U?Lbn83JȊ0$Fdzjê#:Mx1tө4,8I__ oF]W˺ 7OoțqSk=YLU#vɐW1-zyǷCR>e#MIaF Y(-|DJ?yV(Cw))FP&]<2D 0kbYqD'39cy_g\݄m?4tf˖ֿ  ҄,KHӄZ4CT+`Y9dB-е/>ߞ"={ldGw&T-΁pu|sqnnBVo.&cF?(DPRJ }kj~5m0 B L#C<\EHzFci, c* )[1:PDb%콖!I lDAIfpk4S^B<7{7l\Mj4RFJ^yY5"US~,.!`q\, |Iɩ umH_)=[UE@B C%h4XhD?S#䫄p|nˊfFkK n7dͭ=Rx9c< MuP!݂#П= MӖM0EWjxIƊy-pWގ&&`^K/!f!w"oh9# m[t, :[RT%#0:2["y R_4kb _-cRk Qf Ozn-m!JXZcyA>_]qsiWb:2Mg(ٺ8|s7e];^8ie}:#*B1oݔ1^9w5:u#R"}V!Uوi vǪza=2h7RP2 y#=eT,]TL2O=6A2{~%tu+˵,`d>t4=tFM-< m%&9wAEa#Ȼ<11z)yc29JzsŪFޢh-]z` NI~J@WmdtiK/V㾤{ bP6(% aTAQd.ѧ뜺@\ax>ys7~Yxjg3kr3Z F8Cl?iZ,#(N8c¸Qv|6!U0Kn9~M}P8s?Ѹ1ڎtyJvhڝeZ)/&ӕgǫZc73p&6dfZ^6hr+i|$!.>\zE dsSXBŚڑJ mh3cwg=QOw'FOJsED~EGWC0ǖƷYo4$^-Vtj6JP=N+~R.h =[_084}Z,吖ɬ%,*ЖỦa t烫Ab~xd]RrÔ,@Y&Mr+A#<xJێr?._>nh]>shs|_:f=uPҟ~ʼ I}L3zCIJ}2_œ&&N[0>L\3zfflM6-I)B1@} S[q{+;EkAnVyhLeky+݀Fj@ ij[1]E*URdOM7g/hy67hzY2}Ō=Y,qoL ﲴ-[)2( F >|Bۺ ,ٯ,z~ɜwe><1}*?/%D9R=&UQP#zRS¹HŠXCsn2 ¦VH1H@dܓn0xhgN4W2EĞZ]䚢2*ͭ ɞZ-iӆJInZ GL/Ԋ qOȮ-GLD0O4!6ZqHn2\h5wUo,xByVHCs;ކvӓ;'[WVFӌ:>q3 ; H\<|mY\H~_u '͒ nVvtVv%e'0qde0A#,/ *sT84 "W ߉"u9&_id{<~oV 7(%}c L]XY.@3Z*BuB]|P^׳`W|1ؤ(Zɡ S¸dn(D Fx4S,Bd__w7'SlǧMaܥP RIsJ,F-W?rV v9xAK|{5cmځc`Yl_ʰb9ǠaesnɮtqJ;p ^.\oqFz[$-?-0Z+L~%AkWhr+.)jϔZZw~8ةEz8 %dB9 ~'yǏ걔N3_A8H`V#;D] __9ΥbR1#NІqTG[VZ.spZWDA aJ-g,^%8ҡU0s@ӖShR 3zA#FJ(i4#)liZh[x Sf+5yar2?Sk3roUEz N/|?JGÆ"JK"ZŇyU~ioج~pĶO#F׹M >8.-FG ,sv+*BAQ']xc]ְztxQp SG})miYMJ|$6&Ig&f=BWgui \j`m@>}XsAI'@>vv M g%KL.?VWCu~U NW$q&/IXluέa =Tg882" ?P48v^ &ޘ͈3Tǫa\W>;P9{*qʁ ζu$*%Ⱦ*NTuG5"Dë)1:9UVG%@@,pdG~\/Ėc;3I3- t :WIVo4Nװ4\t=?l jQo`,k*lxbG q)z'gP(Y:-kH'O* J3M~Ube݄X2-F UGl80&8\^of>L&Hm1@}B  Ovm^2Y>D3ar>t~*!(Bo -_[>B# $@ebݙ"e!J {ʾ`!@ḃs̵lt$ CĭU(-.;$oǾ! =e.dqhv=~:nJQ_WLfw_#{ mPdh]`wq:5f რËEիo^6"|o*Ա*ejPQ7Fƪ WF){nmq@8_\6ԝ +c!PXC,Oa?Nĩla|nSz89jeh?LIo*=+J#^> 24  }0Y YW Mj*{/͚1'ME:Ƃ oN5"lE7\O.0ĝmZUܨF?X~ _Ez0ASdsUi֤.d|\蕤ACoG@Npn8ՙY~jwBIJ+l׳l#xnF-ȥB [`Du䋽'H0)YFAUpr\>BB 'ȑh;Sn - E<\?dTJRZt-TPf3ߤt*5>)'`&K {V} B5s&4ɏƅQ#kCT8e./44a?-o]}#f^D@9N#W7]gOHR 촗 dGZԹ4t2? ~G= "ɠ ,aY5k cE)n`ܕ6>J?6^s+22[ VQzw41Jpee;BآNdg3kz7MoH~ [&#,Z$~aosnL娔M#kDtۻ &sI8V4n#12Yˮ aPn7>+b{Fb65]m9ȁ@Riшd3^O_ew[jo(*rY̰嬾jZJ<.1 d^L_VvBԈ8kE"jCK\=嗖c "ۛE[FX8=LU67 ʞC4Nm؂%RKz!$R|RO7܇ph,YЃu*ҫjy}>;bmTO =V;D-$AF̿H7>{vao׻~mW*` yDp)=A-`}`e[֜ 3vVEAČa/yA D[m ZnHnK ]+;ڼxoEpߪuLQXO]qLmUQO3dBH5ds lRP+f]CgЉɱˉIzΜZoJ$&iqFp!Ln+ _$sZ#>Z27!KzrHe85UwVr8QC&dwtϕϏٯ/X#8E1>|RМV.Du 4E6.Yu*uDp^9M#]Ysh:{4eB kc5R`a)̤hgsQ.F1*Ba˒VRt-Di[w$]sql5 Fذӕ,?#{TJL:2baicV,%T(=ECN\Fa7IݢL=ix O]d[ָ"< `J؊- ]`kG/P3]>.Jz,KM{:0Ү2j)ʺ~-* 7%J{ȶ+T \֗zU# J8PD6yŁHX/ZĶOܷg2LͬkŔĭ6sfGD9-mUM*@Ca,x4ȐTM\yD+a2{/5-ۦyu6k`/zy$Lk^]{/M>*X+RK{vԓO,QxBw;ڮ# @{o 6VE2 !i{Q'oiǏZ5<8H#0z8:¶rNEV~`eYb6c}KTq6:x|1-hm[ 79K"}U٧8W 8_ Ƥv|Ob r>W/H ޲'nu:BM:cU=\w "8dS 9Q*y׽W6m@3J F!`&x` #xڍGI <TlMerAR<7%^3 `\H!x1YFˌVA@EMB>zփ_6ħ wPeWn]+رf:14fd䂰'qq !H>DWagj,"%n,TTEV~ؑȇrodž\kδ۶~ٜf@= }lRɇO&e26NF%F`ѲGpg@*_O6~be `#U!>];ߛifk'je9*+tH$˰'{_~ڰ}b5}Ba' (sz;LVDgHb^ӳqt{b/B&'~4<Y(qUOݧr^A1ez Mee4V|% 07&lv'Vr!C8O%jT G픈u^cp7ݾ왙c&{)fk *N n8n*oD(΂'J ;B[=4hYM/D mB";A@|'I,/2tAB5Z. \o]6񐸄w9)z䪬2a58y$&y ʐ[oRRмڗ͓hrDlW5 890'p9gX \g1zPc;)JNVe.% Gq(Nw}(#|wZE; 9UKПe\=~w;=T! zY}5~)kߢv]|L$mRI,-`@Ŀ$j :gF!}o/r]uz &'`#Xtݬ?fMG+"5k/>YqUh0jÊ&7=1~_M1i6t$kd])Rfk ksE R/]Թ5ϩ=ORɜKS?qFІFEKiig֢&!я{1 e% 4,4W]yՊ1_.B;e pM"~zﷳPhUb<ƌGGD_艏$I RN5CpP64b$EV#g0>~"K UHUfp.Eq@h=Ήy1lN'!) Tg"_uǂVH6} )Ta?wĞH'd.|yp6<Ӭڻ\Zf#o ϔ;3qa֤mhʮrMI8Z?+o} \W=ɽ9 ĞZpG ,3c5LoFӫ.ϓEjՕٺߠ'P)2yi@ 9ڊ4o7oDlƂvyN loݝ'BhTpѰ$.QE?B659NMpuTP@ƉEUSU2X9lo`TM8Ԭ f sKCǬQ< Xx$M&D"Ҷ}I!Stc6;O<2 !τ+~S;+2~>8~@-nVEWM;,"M6HRXYkۦYPXAjf>Pi fl^TN0O[د-Sr0u K=N-fkvW%r<S)ѥJ DuBo68b *;A mABԦg6m' wVXº/S O?.c_b -:.8V:t{.((=VATs{|G%6Gb2 n+\c?) SԘgz=EmxiWk C.6qgz>HlFü惌 !(HG's=tݽqySbKQ_nbn MֲAYVlfo 8=(~3F:L|]1t5x<%— i m:8&K>G#ΊWVuRF{L3 gN2]B90dz#'%"|f~,WL~}|_܈kKE6ƾDv ƅ$ޅr%3!Ѱj/Z_ flc>ZQK7wQ[A^V/ $BFbȉKw%i&trit?@o'0*ј SژP]5RWI:U|NNpcW9dWB| @ B|O`~d,  aqx% RP`9YÂEa V |\1qq0Uo1'l9Et“uֹ|lJr!/~88WMx_GB Hݩ{^U:gZ4wj]̡2EjɩrK2NmT`Nq"IO5gC>Xu W6 ֱOhn-_˯р,IM~a@F@4q(Di袤V3+tЌܫl_߀oIBa%zg?P B%{%o*J^u~wv ڻ+cT\Kǐkxސ 2U rE)UwXmJ`9qoGA yyץ!ƻ-/؄ lM[A^Z+|RƀvJe"D&"K,q-7S@/Sۺzqj(Y܆9ncu? N*2Z [ cpprا:p7Tƪ KYPg ߼V{Ĝ"Hu~FO’Qz5/y ٲ$qAgG6eRUةfZJeF@,Y ~~ή(XdAb 'BCŧ ݑSA_T+&Taǜ&$0Pn%gk"b|s S2#7b`D_n՜̯B0za9}SL0 Zj%wY? PO',OEd?M`3_" -IfĚKha$Xj0X>XT2.?'U;/j!]OV#.}?نh\KwGxwt! 隧Ȧs;WބWou}脋ɵ`8a` zbj:E_GkC̢c5 ~ /tyd뙡킹դ%a[@CYҀ72G(@ϯiEmlGPBAKP{^GXbUh"ܑ \ѽU8q"WjhCJe<vy^ 0GD'rG>&\PbޟV>v.5$;Ec`T!R YRi x%|n]_ʷKbs:NUvS!+k@P|Ȇhnd/@ɢ"8FӆJMZ |B#'ˤy9ou P{qdF!(4whH^y?ͪpEQzwyj}/2(JNn퉳C:)SzR^E“OEJz&4_bR}953>IrrrW6ke[8C;@g5M͹"0tw# CE ~S1zVT34ahZ Sx w[A:)ȒQ^m| (r0ԩIޜR[~}&oNn d"Xi^**mևw{X3H'n&Ka8`lNdfPZｌs`bx&/03YUŖu]WK %iE jӬͩ:J|JAI1w G6M)^ITӚ/s~v?y?UXYt%c--HWiGz]䦦t(@]EԾ?$iOvU)|nDG.(qy9߉* [+Vv"B`PJimƆ ޴# lR84`yo~5S[20UQn 7I8d) Ll;L0.~Oҧ҄ I<|ǭiʹ+q>3LhobPB<9IEGK6b]b%Oȡڪ{@,I?=pL輞lk:7pW]] ,۬MF}x1FqˇCIkqiff텬xyr ~UxPmɻ-CeyDf'|\t)O;-7wn}E.(8 ?oa_a$*ci$3ּxNNi95>G} LX+mGgeA?,oԍfu %{0XZ|Қrَzu%,7 >bպ\Z <)6ty`y"`%~ аq+iǫjvֱRRTKc ڟ_'FǯHۏܫ]YZ hP?4gQh]|=8ֻRןh9(L1WEGѝ>Y 3rBc;IVTӀ'Q;N"`MqM◍:ʊǫ',j~_*~%GQ`1#y*![%$5"q '.Ӥ~x^Z]cP9EU8>viu\m' 1" ÉB~ɒAkmaűX %}}IA7`}//ߵv_ffS< ;!F.3 y^">Y[8gc_b$ ` UWc;t \0'ϝ򃘮 zP2rdoC ³|04h./ڤ9F q_J`.xkcAv55~MP##`b^XCĂuitNDeWG7[Koqo*̿9yÿq/SKWBKaL: 2w;[>YO#+##߿ XkFb<YaPy$i'$Hֿׄ7:H7y_o<7Дאxej@M"(ӉBC|wj ;ޱ .!W)T: 0_B˔t6Ol{yu:͈0Uy*(#7j^{1_S^2^_k?@=SNjUG?  CW-Bxɹ?y&pT&~yO2,d c]A-xe(,/:g>䆋g>)g)=kj'_)sġi֗Bn]H EQFy6 *#(WJFǦ1%&rBFO2F)'&]\3U߮gRŵk )S0fȟh'B*zu.oH*4Łp(~DE& rr4^}J&]@X-Lj(uNRŗ`!03"Y l# p) ]EX96x6ti?B@!*QۢM?RѱA w:^\ V+R[c'휿z4rgA?M-O L%{jU;iE?a26S9zRsj/{p 'u$>=@f tՉl55}-͙5W{^neg#bX&:? -뱰]~HƇi\nӁss)˱Dq4ƔC/cE&U*Ga7}:ZĬ(Dzx({&YseFv{1V,п"7CKz'/'EO\Om˘kK#``o~HF _VyUC:Tީ0NE/v;,/lߙ5Y;KNv["7 I1NDK9~z&S-=?Kk̳V{\*PUElD_GZ!#6gzz@F mQn޵ O7GnljC~ȂVRE.r>u^'L9k+#؇:,P'&$FD仑^>^7RJ(r.ʝ)ɟbye֝xP 0Xc לK߷K~id5AchmJ FW{QZ?: cЉ3Q:QSE2چOWOg^ͨ;-|6Z޿U B3;# h 'fmVбJUD◠1)oX[FV! 7{Buz&payw$9wxIJmuH7n {fKt6Atߋ?iQ1BTE rJr|@4?0j_pxHmtZ`\zTHhWR&=vD,~BRg\K/Sqtπ5'E6>N%:7I T!R4My5a$4);s9Ie. 'ż'9/MW) k,`7]XWA?%9:: ܑ4H*b(%s/gN4XQ$ՈT0V?H5>z!lUjqp痜{%mk5[nv79!pJA&%F"M~LCI,]v] =Š? ܵ+ ng%Tr/ש>9U5nFptу{rm5L;wba)яKfQe`?!|Ă}!\kno;\}m0{:0j7Ha0ʠ>ǢO^yԔgx`;j!4[tܴ}K"6f ? |&idJˠj8ߢ"vxRdN|x5,S0,Y2vް#3pbᝐ{f~CwN/1Cj|+ kwn ҞY= uR d,Rqi}o< H2okeȤl8m()L-?Ty%iLlOK렒hͷJ K1 )"TPJ^I\YчʾOBb7ҁ"v*QaWYCB^ɂzmݒyOAxxQ[ ur9Tpm_~xri¸xQt!v{t>T?I %(Љ"#qw$)&jEIO&<@%:i*a(" *UOpr,  #(U=p1b@J>wYmWiҧOSkp ϡM|ƫ|%lMj!G&1Aǯ e}Hn̺7Dv))9sCv0!_!4@b%SBT/%çTZ^gr#fX0YG'H6ɭꐔ$+l{m$S WBUs*ihD-zPNP'~f~Q!eB}.I bbnP50[(]YW3/hfgHrS,zG-E$hl%BfA2B\7m1͇Gĥկ -k)KQ~2%3m$nZ^\T]Vs@*$4Iδpޔ:粼*$*Ɲ`ūHB xYJsjO }NOCkG.k%˴ +r(L߅`2\rFq+ Zo bML>L>#z7"|X"b?낟@TA㺻I:h 8F;K3mYS[eRly좕CPaO,qO^' e*%M  r%1+̮kA(]tчQzT58:?Nn?$^|5'znU+=|FPe!чE,tp0~Zr38b?EzA]?q~V3 RAEh'BIt18R~^W="̭9zsBSP97a<}71bG# !۟V%iS.r'Dl֡r߆抇~g%)cȁ3H9rs#Z%4w_0:=A !+3n[wu\efDk%$t(] ɪI yS89M Т0@kMGSIYV|`_IS0B픬f;$RqѢ+EOl`[I'tqZBbC}w`-M|8)av Em1Xqv$WIݮRV:UksHisD+GMiɔϸmQ8OI%|l LM4T|Ez,ç]MYt-@7_V?:D*dG+˗*]`;n<H 4+ 4Eo YL IW]yjcIr#Mz=4yW ?f$' {Y[R(pÖbuǐ(^Gh:%mfK=BX.s(/l_̦#/^I8t(CZ'LQř%9J/adU"[Ͳ2DAKR`?UTk{&%dK4,_# d4fx81rj7c% ?(oM_}xKLVa `\HZٹvLyDx&U 3;zr:{%pI`tHAM/(^lmfqs!Y=B;Ch_+5* T^CPYD2v:щ5ImlқA|K:*yP_^(-q8XLX(04D2Xʎ!| FHTZ;HO߷ᣢzpEJa`/DOW~[ }%=LD'Q g%u Y#ߖ [ "⍝=o\Q\ub>D!Dwsa?Nt4Ѝm*pF^XTU1i<6(wH;V,EnR9 ?iɞ^Tgt@kIL5<oy-[$PDlĂI9YQŠld JOg'cObn?+ <Ǡbx VFb^`Us^s( ئ[kGP|4"k8McVEqkaj x24RJ "8N䞔*/⿀A b|0"K}W%+Slo}*/MO/T)4X(JOikS:4oB:},,fj2g<9ᵮ,9FԜrB;3R*0,ef#sj|4.ǧLw~֕\J^C(Zjzd=dr檿Wk{zQ:r_iosVba'Кoo1M4(mG4Uz%/m DyD#ԚlW;Syw^)Of{xFhN?W-)i竄AeȊs\g{ts?X}tWlQ[8ܿ9PMK[NK3a!> ?, ЖsP(ʀj?i=KԳYmtI^Jc : S ܩ;h;^FP`^ϱTmWBǦL_-RgAio.x[ar w&aqC!GFPM;D *FBb d_yZLC%8U *Ύ|`mh6*pV3ݽ!7Ɖu{wDѱ{H@5lvFL}8p(dL4}us@S+/pG>EIU_皉o@v$=!Hݢ #LӨF: "rs"q8EЀYL7'`/ η*V Wz?󊽄t ;"J<2 vL  ȂRD[`D.1bi&V =P'3՞M<w8V"V~#J{"X $*1x-#K硩w>Zw9YxjXrS/sg9nu|(Iwpz;sV],go=;921 lʔ5#mޞGw[1 zgwK!]I+J:<59{m6I؁Rw+'"=_pΊyt&\N9)l=rG̗lW?;1" _?4̤ƿϝEþRen )-Ubh 1Tjt+~meͼ=m3!+  AՅCWy&A:IVH?d( C|LdŶS K`E !," Dd61?v`dyx̖9 3M`ױʏZ>)Ja;@օPth;1 4OW#'ܩ8x=/IG8UuqW3ͽNrPLuS6dыΞ \ YlBuY$3A( i1@mjUD[N C/ݰi,Y%]z{/o{kO_1?79޲d҅jȠsϡW5։)2YtVGmG @j2e cC%V`+|kb_l9(JDg9** ןr{SbMWE =XsZ j?@^ᷤ= yX-.9F6>[2;)?j{DM-󓋛Wؙ=us+ԅF~sjRaIe_r[28L_Co+̴#dY1qsH s:_d;#f)k aGq2DEʔ$ wE2!扳Xly;އ\l3`0su~~hys׺gO9m2w '3(_/&9n*hQ欤 i 7MʯY(J([Qu#2IJ Ie[$nxd>LY{&3Eie\}k8B"|otKҵ@ @G .SL0V>0i æ3Q=|0:y&zj7"gZ.a!Y($ f.|p`(؎03& SR8Fc6!\1e;X3 CJy˝{ m^NxI+ "jeF]Z~H-'JwW݉R@jAӶ !c7{vzKh;kFuCrUUq̐u9ظrn.i#7BK︅8T;EŒÛ^\R20{V@%6 m|=FcvE!Y Ae%-u6b (#祗eghiD{b*Ds5`KND̸ٞ^ \8(2@at?OM5n`"Ayhb? tQ%~ 2X٪Guf|ΞGbTxCZᩈ648c@c{7$" Ky ׋d]Ydq>{254>Cd%%sN~d 1v'r?ki n ~$` ?TA,RL~%7(!Py9J ' EWQ^!EiC/à:B+iYu ΤeO$s|l96;%Ҩ|Q,OcQr EK ";,in6&Vhd7Rd?ٖ}~X[ pD dS,5}sO.ō7I[T=b3%1EpL2ocv#qk`#9FIm1Cnigjlez{\KTK- e-PYQBG!8;=Yl; ޳O>"c3,Ƿ?{:}!C~7~`1H(lo1RT"k;\KWjAnlҎZgJ3DG~ HO8T8SEwr`[ VX]o:xH(Z(Np(_z(/,k"o/)/{^#NL+RYpjHţ1`ߨxC~_u7'*1XdBM;'Me/̮֟&"eAw}OsFD[-Y>n^IcB_sjt ʧlc |,#AA ^^yH$CE}$:zX;qj+y$_;* v¼]C[zgVx+!dӇ@{;}B1mA41A,LZq%,{|b|`=ި0G4+pul:QQ/>\0t:SZ҄~U8hȈ9 (@#nOx}Z[:q7hy^W)K oNð_GKap2ZTbh]醔µVq罐,~1L\2F&03  xho"rZ3hj+CS.e|ZWZ:/A,? 3+a&J kJr aˊ; W0Pp_[Bm?w*1.}7v-lT\D+ t/%Ю;n3Vɷwtd뒠BġmnqE._=ԍkOTK`L=m6BZN6(<;ѸrA1湠!REVe9DMnjv ~TEs?US8<-('L4bWk MbbICR,ǖDoU>`oa'&hҎlܩ< Q}zxA㼉{E FeکѼze64&mەAEB][$9eb)G6mU8᥁PG$ϣ"8dWeVLUg|:c"}hb0V2 *D$oö]\'mnGMk0G wpVNw!Cˀ T :_q^GGPBbVS*߃[ŌL321k(NOKzG+PvtCC}LTҘX!!8(JR9'6Pq}jj Z{&9C@rK-:xha-$>b{ ?^E8Z*SpQL64:(v8gZ{y^>hp9&bNqM82ǃO/)S{JNFʭm 6l"ٓ dZj]ڵ,8asqs_S3֚=j`3ݤ2R䨘"Gzfh͓@"=X+v$^I"7 YE">LVɗ5/oBع{<*#yJM8!#9]SX.R /eH|mف_wN(%`Hb>WsEȚsnAC9_IQW^D;9=WE\êLN@o%3pߘ>>ף|.B^1.Pffft ޺v]*!aMM}'.F!ү8 wafg\# o¢CE.lip74 ׅ6cDgtЀ$T]<澇墌y!D*39v b*ck\\C/9tz{]p"R+>.v;V|tRW^kw:\'٧K&/K~:߬O4à \t _ZE];;mt}JՍ+!1nϲe)x:dT]iEqtj=Emd;&& 7ki8R Sp2UuڢGn[ہ;Ur!zcZ % ]=@I_`/zymΔxѭ~`=ڜtX"(C";;v?v.K^~Y?'34<HXʗp+["u[1Anɦ Wi@y[+]̯Y33LjκC`nh1h!K?]6t\ђďagШ28J C"Ղ03;4JK(HTEȁ쐽2X(=6[L:3EH7ؤW_C۲V72 JQqF5 p 2`s>!Nugfjl H {wM됈^*뀆]PY*{E|A, ˶`wM. ʢeXgC]Y׊òFepT99T0R*L Hީ6`6o=SG2R"t'\?>A.["lULG#xc__{eI(1,Iyz$C1J lVe8agVoI ѳsS|?s!gp4p?IOf hF|1h wAln@IFm ]].;zgaؑҢjf[ d )]CZf Y1ٰ(ωw!::칄ma-YFR ۚJh :);V=fŜJBxO~o[xm.LHw뵡fq% +@5n΍%j\oHMCޜߺ-Ph=C쾃 y9X{!;ۚYdF*֛ :uFT%6nXӻ~Z#Kz_\ƹyCzJz1g3*j)8wM.U4;u810m'> CrWN6âb٧Lx$ Z|hlLCY ЌiR6W!]J=pq s*keGQNK#zMq3|񐥛]hGJj`?>ٜ ǎ:JOyh~ݝr &tṇ)rTLJt/uן@nJV`XϺp"Ob߱EZ{9>໲)̥!0Ko3 ae_du$qRlG,,'ȯ=eeDG\?-6̗W ˅Ϫ޵/\ ӀgZ4lEjV=R$-ÇP ;#~]EL.z”>z&}̿o^4{q1o1<NALO;z"rzsRD SmOqak ?Hoz /&H3WMؒq,H˄7,$fw{櫖*< #NO" 366>ئ9Aox09Nhd=~%}Ѡ$Rr53BY"냊Uk32-M79LK▀> V:_-*V借I44Vh Ӎ+`-DzOBd~{7L(lm.Aa5,6rTA.(Yjt`lunfnP>Ug>ܷIok;CQU_|ѻi6_H.j*$ |cCSpR7gYa⇯SZm_J,IxTd,U^E^Y5x2:2KKʒD dwn뻏RVҨ:YoDx /|s>.쑫#J(fVP[!&5xG4.޿z]5=+<-ݛ5#{Uz岶no*^/^&w5tr!>D91wR:o@*KTz3\2 x5uL2^9 z[ٮF0}[ i`u&@nbfU㗚ѸQrb8]Uoyl1֙L8;*YHBLPpSḰ ]|ꡭ*_5( D"yioۭz%VE V֥WۍSAH*UM΁vqS:w5?VDs]S l2.IOCB [/$[k_%ww贏m F\O}DM_EʎxNt9-^ yW/ F !ż:~@ĕ:rJ~rȸ"{6<(S‚C, 7Vn?plE ny8M>[s ,8VpmŚ-@ga_krmќ]p3 ܛroȈ%S^#SZ"̈́$; "d6&829ssan(< Ysi쪪FGyQ-T'Vڃ*p69ݤ_t![e٠QĮ[%\ei33 1XU4~3?nZoF5s-b-*%0^0HuXJDb-Vbi4+awΊߏws#7_:= a?h9Z2rV)X "q.ͤO9.֮؋Cs;&vױ^|ixAe;MnVCy*WQ|hʞoAqY;$Xӗe%j~mw~7i>5vlI-~HV9mNۋs` : 19&LXA;x1fm a2ʨ5`hњ>5&j^WD Ub=@9-N)BP'{)+XF_l|I)#he}/7thljBؿRj@:+bLT@+G&hCVS ͫ#4^e(HN v{ʄ VeíϺ Qo?U\j|'!ѵ,.aլ^ <^FDm46sFVƌg*7{ڌ/ʃl,v1V$׀G yjGۀ| #Cai#p'c7hc8FCne/"+\ߪP)cv;z,: + GD$"ӘsV{߻dDE-⤲zr? kUqދԠ}gi:^(2#DthqSNF]"g$w*{>c:;L &\G)[c8⣢]b+(d'4uٛ')'-䔆\7Z'BG}ٸ3+AL+aI}Z)H* =4:xIi |ǘ}ܨ'q!ML'YkLI, mϣ̞.^]H)C%LgL3>Q*xU©`.<z=](rz_%ᩕV|C@'bڻ49<̮EXHu=VhG0kvÝx9 ߨD ] +:?]@S `sP~3TfPGr}c8u>TSUTuK  ϳƪ|XV1ζ%LS;H0v&#/1Ff^ N>V/*b c$בxcR, Fqo=әi5K{ʮUυfki%`7pRekyK^Y$rO(! D^ځ=%fψ,7kh$nQ _MKбc ߆;:`Q%}3Gphi dwk {6F"C-n*IdpFM`G;GK3s$`).-o|\R̩;0ng4uZMJ7J wZMjQ SGFA]f2?a\0Ws?(w UfnyY("$ u0%_3V o%p`r%A ^A 0m򥥊]WfvuI|o%L3JefS+i( Y6[ isC#h*Kx^u(>>a\ʄb,8yJ31=bJZIϯ_*yW(c[WF"G NTDs1v8$`p^,0}@q"DCvh^t_BԆo Fh3DE_ĠZ, t^h Nu׺@okc PbhhmJ/OGn4mgڷFc]<@;izsLk ܷM x=3QKz)Ё<֙beS˼{/,_d~[Y7:"io'Nw0\)Ÿ¯Cϒ1znAzClg1D36:7+H-8`-Kl[fM`=(2iK/AQrys:Lne m:^xV]mɈ[.ULk6w3Ƥ6p9Oӧo5kVRX\=SÂ2ok)Dg>3OJi9KATz92׈3k]) /\ې_:.% _,'CoMV"lPʤ֬d2˖JvZVj!t~B[D(a, vܗ*k] '7ddmTx(ZJqyY}uQ)]jW5#Tֽ(жptB;.tƿyj_7 P;M'i%k;$KPoAaʻ4f"&+fԑv56]Czh#Ũ+z΃qp_|X,f'?ʧD+X>n)CZ\,bxq Y0/Egr]` [3S&1#!)' iT~yE J[K,(EMG|g3&T ;z~IJwY>&fA}OjXh}4k$ vlb!bR+VYi> te%АU= hgvŤ!Rǵ8;cdL/9x巺V*”^HhA}c,}Wx2'0U`Kc~O$ Ӎsfd5G >u%6]KB3̮4b?WPA1+&!07 b2H 5Fiu0'`Ds4ˣ1@f֝ڎa3̓:}QOan,w08Bɢ#r9wajk0Gep g18-:>u yc{:ջ!,&DևGÔdnc0?C gkh_֣}Hؐ+mo&HN)7b/AdJˣ9"zj^e74& *{;<ք d !1ej܄@B|<Ή_Ul]\2_')nZuf';(}'<%@GW n ѢN2^溕Bi@3_Q[X+64g4z"t@t;Qm1Fz{w󝼣s}^i%s&< M>2napǁ72H{skJx a!ÒKn'R| W(4O&1k1ͪZg\ϧpjy4 b[ OOx$Y")+B޹vm O7 i^ ,:yx:0A&K\l99I+"?[kc Dl|QWt֡2NHu.D=I"RCu:RZ X|qXKwdn/ `yayQ}(?Uv:.aLsB-ӱ6]ɠ^oq5ZrOoC!Hˤ\t=ULq2!>߳6uaQ_ Tx{44tep @[A6ín:Q$yX$_PR2!duDqA} 뱏L=RMS8pCX$Zi]tKK1LN\c\9]p 18l פvb4w)#TQd{zRJvр+b;9[%V"њ)$7ĊB @C4:gzЙ drgxus,p1̶WŸ)fq|X$a,/D[9bk.g`S? @On& Zi^ .ox ob>.RnĽIWY9'FM6ΊԪS_XR/\m/q}ޣ0l$?C2H1^Ri] C (`}+˸i)Teocߚ#>/vXh')&g@P5PIA8X :ыLVō쎻a$M5^,\ 4 B`~>_euW%fZTO8Vg"Il {@t~)"BG Jk酇߈*])&UnP`ǿ\OG:7=n 7 - caрLAp2i]fOw4X.x/|c2ŲW:/X[ˁo>#60SV?$[Ⱦ#RtS[>cOb78Ļv7yp@u?ʸ%P^'犾܅Q-DI~koxrsE eZíb.Wf1s_r&V=ӯmz[k.VXd|>|Uw X2 s%@[{B"J>^O3F!EWܠk[JyP`qk2Ѧߌ.]H7-gw3Rs~YR('3|^C:ϰ_8`%f}}CaEk(pyzLa73 ;m޼3gPlf[.RdYS,a,IH`zģifrkRBb0B5i/{gt_/_"i ?Y<TuN_C7.(K|ܙC W&Z+=X: ،S}vtzY+?OKdf!JmmaG\:̮ܼpེjߞJ<8b4݋oƟ?X-mCT ᤋH6HFg2 L ^,ݔ$s=ۻNDM7>ءQ&? rm<q ,5\{h!U( go]Ӝ{XƹmkܘBw#A҃@[3_ӭm(zN&Yy $R6$vZJrFo%Dq9H;p SmMR6(6kݡXx7[F^Rf8u=puvK6R~r(o\N_g`횄\㤳jE7+kt ޻646xO)nqS*P u3an=g"XlU8`dѧklz,@=:7c2~}/mӱ eD1K *vec * *jmkh>@~*s[y7}B /8_5ū#?<u6*$:u?%Nu)㯮:aྟ߼JO/;Y>DaXQB: NlSvQʥeuT4]6) }Sg+w *y WYJ!n'AP3_x'E1i n`uߢ {g#9S&_=O r*xerZY?>4GdMdג"(Bt]!lnL%i4\[hqwF^;VUd]iUws/ ]b:P:$ .X+)_镘KTXg[daqaE 6 QeZclGdK2[yVw lm>chf4_7fxz]nC6lbl"_[Zx.%X!@2!I:vgs#: m>&S`DY'Lvץ5$εiPz# 큈XqtH"'?%m>3?{TLf"! JUsq U0XF9|(4$:vRǛ{!XٚMyOLeƊ6RMiK Øs!%x7#u]I,eӰi\P0~|EfѸF5SIHխD?)#v7)52AlkQ&O$Px 'k,5`x-iʏg\(|>_tu'U˖b^p?Ogw$qڼQ4|F[l|Y},÷,fJ}ޘrlYӫLMAyje=JcT|LNEGz$ oL+h亶ڗWyv&[-(\xWI^Qf‰u4׳9ͣGy 'rf4@gP&8:33o%>^c (`_\E6 gXN<<6xΘVc^N%VGw)8_usAΡj-Cs &^lM *[`^&h gҥW*s?7{| C d2s9>$=eGvZ&5n-l "4VU-/x u S놾jF>Po5"\ ڴ`Ѣi!әqT쿐sWplT $;fVږ )Ht&7d?y r-!6 1T2XB[5a 6xfR%r,N낢L,|rQjNL4]*o0]_z΂n\L1MsniTlD\)T؂N!^pd*gdtozJe-u&>Ye 58~AusPRGؼubiA :؇%Z}Jg릟9(bl~pOE.BD,9UۯVbQ:ڕMj)j`o`z)K? T+ ` d[Zm} m^.INaYV=Bh7&AYm9eY 6+Z.}4-F{#W,}E<91Zj;93L'q=ߐn+$lo ƇN^!~j麠1n۫=&@8ҴN=l;V:*SݙzJDϧX]/}ƀ GO!Ҿ3I,P _Xdr=%]3D:9o5 T.jOឡ8? 0/^G+ڬ54of#xPʔ\2svPg^i/@kR巺gC4uIqr3mw/bmu8*Xucp~4 \\Mۣ biLjdOg|ڒָN`|k#JwWQSmhe.WIU~I1ҺtŽ2ˍ AOSgZ@C =70N8?Z5 iTEܨ|p~=mAiĪ %؜B'"z/n t*@MX"%740#XGRtI=IAg|#WbhwBlp=ٳJ4ٱ4ABO`pkv ĵ@˾g{W6/[hh4郣J]RNWk:0PD~U_+u.nکI MVF$2 j#ˡk'{Frbپ -xp8X''#[O񏺏Oe\mt2qUf<ܨQ"2-8 K+gbQXXv]<_WsrlN|Ӏ!9bJx28n1>;eR%uŚ3ILk!$ fA~&e,YZPgd-`/87vZ=~YWH VL$1ln.곌aPp& ;f=Z 0Gs4{1[aLUH:s̮䡍 9X|p#|Ź"xwcRS43 =9>v[=TC^Y-{ 0i-6x e;űD7Oec/\ N9lϋcwqXKʇUXP頰@MWUr//bdc3`4'L}ʥb"=:f wpNFIs:v+óA6xSw* ZŅv?ԮJr݈ReXn˷9R6z ChnX w PG" $>iU'!RŸHKTJrWQ)Z|Ҷ_,tցsR\a.GKyAu2X4]Z/Sm$Q?`Q 猽aOܸU@^24oS}.jG>;OQ$7o:YA3FBN*`tJ٨^0a?)1}5_y"#51#\6/0řPܼඣ+ F3}R +%?tḏ[ NYb\2YOujBT͍Ca]/ ·hZmO+ }9($83 "1fY 1ӳ*]s >f1ВY AUݯ-.8A<9!c!,rgo FY!n Dtڄx8T#~%1zAG¯gEwu6>*KBS>tW>F>W#@mm[b[:ceUЉ߉3\HjCby\i[v"E 7"|ۃm8R$6 AH S.]}Ӳ1%wr8#Ű 6N} S_bۈ!ABmumRNH= /,àSh jUo_d34zEVFիi;<4kjLyԄTh@RLI~UZ8$da?OMʺH\E_X#-,R$S4ΫiK%21{,Q~ݼgH9ϊMBp-(7)Z OF]\9Nzr)YjBv; e M-s)&jN4>?w9J>QL_=42R7ٕ+5nvdQm"LIKp^Sze?Ӆt>Q +p'iTH!H;鯙 +PAFCZ)(2bpO З>GF %K,qicS_@$$jUb5΢`'/5cx) q.;?Q_ -i;?BtYD?ΚzAJeB2m+[TbAb:ji 'eh@]OpK!`!>6vvNUO):$Zl=扎wAW=TJrUo--{: o | A@b3&ə 3wZ辿bCM]XyG``HbIh*+M{=BDL>jh{qs6T~V8*{3!] gS{J' Fz{|NCqq_%hwNo8aCu&d>,;JuZOUыg- FpY~w^L}RJv8brӸbVdRj QoMȖ# m_2/& q\eXk1 J 3JAeO"9931UU㖩VwJ$̯5Q 6㘖l Ps-;1X\8Vk2s,gdZo;Oh.[Лੌ,W~'D.ȭg͐FF74ϐ yvȣT~\ߐ%s&1')%p2N. @e`-"? }OS=xnIJoc`}A9O' ݘ U[[9c~w^`Qꪚ벳pw'gg*j0݋`̦cMCCRۯ. .̴] ܄jSCX ROUgxW|j- (I҉qB6{,EN _b#c"%cktys۵^VFրꯃ7~0]0N}Bh3 `(s9 JQ$cb˅πI Vj@\Ѿoevͳ%p+L݌U|R9)c(/O$#r\ėmaD86;\Q^wLKg;1O)u6+{(+ׂ̧IFT+|䋊8)?H=(lE<J D&5}Jh$.\-qƈh Ϗ5F`8欮h`6䄎+H\y$"aÉ YBz`E#l$ bTakXQ|ONx p )r3I[fTV됇:B|K[/?@q",Ǜ?I_#{cw]%wF|b*aAc5ɯzw7j>81i(#^-" s)Bw,^yfٸ%dgT'bT?dT_]vX O_ 6<ޙH\qoag ֆԸ 5-LgnBl}aOC%SzG n)M_aoԢI].D('ʛq=>b6(oT[2"VG:*(."Oi݂e0W8wDվ LY9?PfqXuť(QCǪgτfoTx?\S,-UM#g2uDѡX~ha^: ZUI'_@Q]KY؅ha3?؁;k,"8Ux}V:iV`b eL$)2$u`LYpD1Ԃ$sgC4' 9 {|*YVW8<|쾃#U+%DYkی.:v;*,+4 suCr}2pG3W;iUVQy}TtstGƟBO7ĵ\͹sUgSHxL!+i<6y dE1 ǝe JpSṖƈɊ{NXv =\##y4 e^z`| GH /+__kPGY-A;̱$Uk6$},?kx%˽i9sYB ./RjW3~̲fܩb Ftؘ[)^.Ro꽆JKsVS_%nr/>^bv :.k- T"ÆiqC"/2 m\?%jp^ֵ59zo.ذ2? TV&6dUA^lD8 yV:9]9y_k4ٽ^Piݧd'VK}J , nLLӷW&(A 0gb?XtT;hm/[cFBtM-jE]_C,e͚3iֿYbڜN4#( 4-2~ 7hডP1؀rZ!@#V[WJ_ uSMCVu@[*Y1LoQLnR OJUvVΈxQR$%/S07@Z8]M7\.y rTazSzzH;jaX3rhaYu:&`!.iG}xK, ;Qpo*7@"jwy78Bdǜ&&u |[|mh|Kȹ_`ސLWR򝢑`I/~xlP6a(NBc.qӊ1{@[h7(P:Onjb;;Q߹Q ]pWTMES9jc۝R۸;<}Fpk{ǐ4^gXi6Q =)ǫU/WZeģ$O7dje>scZ$Vg<4BNH_~-GeG1͑U.I̭P;M87g͟n-q"l3^ԻBLPDE`)^m/"0{n2v10*d<6bX1iXFg}}w}J!dh Q|$ m%&Ors<|9^&_s^ vnŊ˛8?kjt-!4U^[WiɎ9s5Ц+;71ҷ=@c1z Ò\0zzAR$| g nH/(|W vTر j.mt㦀\4iS+AWL-H-pkٙV=a># KӉO4W#!DD( ̗hsxo}:?h|'Rx{|~M)ըC@bM9>Gvf@ÍA־ [KxdDϽqO"SX"[p|5-=NljY|`N4>*n'm{.YcTC@ՏZf >'hQmExWc[z[a"P6/S)S>뵈gFpepEasiNuG7#Zz&-hʈ^|}A_F?ξ(qežb.F}91{bDBHS'z!wLiS{rÜ.H:HuϦKZ8r+Z5]:t{]2z?K,K. $_~x1Q,&(4G`^Fê#ZHwвV p%z$^X}wem8GoKTc9H c$xH3Ws) 0Y0=۵xv[I.Y>T:Eu#ZE,e T70#\}z4hgpbs2@!KXrȣAkGE;QtM_Q"(z:i055T裿| ngT%vjX3:@T%\G8]gE;mܜbK|dV)|\׏ 7}Є~J!]885QwFl )U:9O(Tנ,94 { V$&S=gH}`7C @TY=T,p:9=5̬d>b݆*՟Xh܌2xf) avna#Z{rFlT3:@7l/bQܦ[rA2ъ "2V>32j/l~76$C 7j;˃VŎO7sTJBoLɢ>+{NDT4CSf"dtUO3S=t>y4+ 'HiO!g揆(ki"_з輷 U*!` 1v@CѳO\C%96VzC9R)Pr).ȲE76sCV<.WoU4r476p4(_ .'J{7xuP=N 3CL7)$ 6G,+tٸf/~޳9]j G}W9$kC4l'ç!hU)eR|`cCpr8](d2a^of%GV|7rrnB[Oc ƬW|MCMB {_wngANfm2G A﷋N^3]};}7*Ty*ۼmLdG,QȔoZ!S,#fJY {4V>!ݫe}U64L8÷Ӳ Eh_ŃJ#DTgLz#ʆ˗1;\/UHUa pGLp N68t^P庯K%,W+6߸2N=3{b B pmQwn"pŠr Od̤rl9:2Fٵ+^-LQ$. ZB]PpD'FXL$} ڦvX1bX=¢B1Gh0I;X A厃wʢ&1^Voe0l-OhR @ĘHmTclhc[B% 3F4,;3jSVN{ `} yh[lDS?6` h@7!.x< 'BFp{۩X>:’ T8^bL(cdWziiƻ2\]p| M &SU=z4|ѥؚHFIFH~;)3 `d-P_X'819;#8zVq~RTIdR+OMjHdaG >}er$]oB3v\­˛>䟆.FSiY0A(t9`#ѥ4z8b!&Da8Y΀;/:\PO}([UP4 R2-`oyw; v -䲙Mu|lmįˣ9~M)E Oz.Xp_p*1yRF+<'mP=;cuG>g#N-Ɂ_j_86 ^[*"N;زC:˥ѫlupNT_24XS*ג)4Ʀ$ЋUVf-VpR-R[aZƦɯq\'+6BqR+QȼҘ%Ӄ$p"5t⥰ 9 Y yͷ" wiiLlir,V- Gj2+ΐCsImQ*}4>anT|_TP)]Q{a #N`Sm% KAa.a3]S~S,(܇@GӍ^rRv؞ɞ2JbUGA K (af>%m/DE;FfD~Gs@VIGR".%XjVCZ~oKҽ&q@G7g/_ﮗң> )lL![֡=Զog]`B"5ɬ8}h'/ضKq,C um9UUP߉If(dems"M4z]GW3!<;{[ǀEJ @0ZOv?W/Vڎ$:-"gD]ĉzjhᓔlsT䱲VK.Egft[2KOwqSd_ch[Ba"gOo OB=K!*)Y̓XC|lJsI л2@Cȿ 'L"Nӕ9:CMG{ԉ׮5eb.^ᆣR45`ǯ*U+blJcWRK*e,? <@@Ci]0thiRK 9uL{UŹyͨDg\ {p'u؞[մ2gaGm"gM8}He+q7,BD=V'?7My`,7] oJ$'Y1O_akn)ZͦtHAK;P; vZOK;6֐/lx-w0 9  A{oEJ=(S)J(~̞<R d.~O+2Ousf͸*"gjvxb/5 jWS̗ؑ Lx̬\Xn;qW~iaIl, $R;)%'H?,|ge(-s~|)r)9:}?nj*>-Uii*efd:1͵I g~?[YOt8o+Sr!H l6\(L6 =x}f;r e!qmïYN|5 DvU#\PS lqDpM-rf4q%P'go;*3(JLc7i$66`'RD.-~#Bn{~`j)/yxVMH &hsP+ĝO6ԙ7 ݦb]XuSWNLf } ƈ?_ƎhW3V,dLVɂ`uɀFH ɷ9h>5SBPק B?;ue'\ʹ;A}{XyE-YʱiО}pe_B@=/jZR^'[z/tz9e0-l CP&Y޽Y3zI[ 1uKpOׅar ZU:w"wIIN) HHED CJBbȅ,w¬Eևq`}qMS:x|_^P/pNRIL$Τ\C  dh tɻP2D ̯aJ̹w-:ӏLSKg(I3mo^塞8:C˪WH Ԥ)4爻ܟE;2O$Qng?ʙhbɽD+K"*i^q܋v&+J{@])?F7_v" K.)b~ձFjl >UȞr.R(*/xٵH`K"*AV !U0? ct"knE_s1;Œ ސd IMǬM!8KF/Bu8$޼yC(~/~l9+.s$!6@^&Pj\O#0k *G uPl?eŗ9n>Aϋ=l0yW Kwb`WKa`qRbd)j43lh,4aq5~Rp6\^&^8vLxXɠȐcG5p[ؙ/6(ƿ9[ \vK+Y؎-Fc^:a j:_]u>d5 }~fBrVY31x9QlxCJ#uOϿ`^R5MdD(?C Ku ~}C 7R/ D[-uGwkd#XbAL kyqm%Oލd3.>m};)}ْ TE];&amGV%Dl?L(s6d|^|!%0FXV_1oAw>bbGǧF5T]r=;w; U v4b־;fPDb֦{ԲiDF\Lؑ/\PTx޲L:_6:ՕQGᑈG$s%βoU@ KQa I[ֿEA2>\7c+LI&72 It gpk. 2)x8H&a2"<ߍzT tKkt5*Xqu0݋ EF_@QeoV+ J!ҶNn|#fmhL-*vd1P74B\<&x[ VD|*" :UQd#":]v1\p* SմGবC桖a8Up c^ěDO"\n$BJZ[ =3Ri_B}Ev p{xLLlظfe"2Br@yЏl|9y晑r. ifw]5aOfRBG9qroOQ& z NЅø#9/Jߘa4ؠPQB,%}B)B .pPllG-PX2BxgR:hD۶¸< U(%dDl1QP.}e~Â]i8]ƂYC4z&UR;\ BQcBHci+j5j`JFbjtS3\t NSl!Qky⼞P]8E"<0=^#mYgT6+"`8;ח1`ÀΊg*9K;w/P g :/KY/AQ*EegRɕ;Xd$}F?g{IYdB:CW2qjo7 e֎[!%̈́wÊq2-ca:bpX` 6djkl0{lށdHqvvX\H}7*Lir#8Y?~ASo͚!3E5jۺye`?j 8)KpWڷQKtYbri2'8ܢ:¸|O i<ֆ AZW9P[׍po#N/B,Cz`c- vwsh-A1BaG5 `a#´׬{qe[ |GlčX+ #1{ ߚ = 2ol":PS췊;I]dP׵Pb['`؀DM\ 1 R4Ɍu˂5+XD9Z I?Ϸf1OW׎q*O!GYȔFOU}YLYM @dT z)l? SCBg(yq#p"/P&XngQg)eݒ0 0ϨflW@)^d4v"n5+zzx,j_C?"cNnmDm8*ʢ{ )>vzA {}@8n z9XiMcVWEkұXDلi 1kǍqWcQB]]q~ fȸb`ci?Hw4HU*4[ÂS|3tv7W LMhKbxIJMv~$=3l( X m>գ ӿP2ikx\78-Hdz}JŠue@|+ hCAyߊ!:/ASᘘLvI,&[ha !2 1Г! ktJ%VgG^NL="7]S j~7n\W-"n]G,h" Y@͈k v|=ѶuGPg̊/cbTpSS|ߢZ iyꔽD/,,ڙ/ ?NB]yv ˑ!><)k?s5À'otU4>P!>[LQp9hm_ 7kc\&0\/J.)JhFǐ9q]Me! DF۩8mC? H1fqJسDnBkV1 Bg\7yXȲ' ?eH}X}zRʎڗm%*b}s8tc@N "WA1gPRPX.u9-DL Vawo>]Lq K/&^o;\Eᶦj6x#Վ~l}JWO}B {k(چ3.'C{90̟1clȏ:=.B(8AVc/3`>XAn"AM7@VAY90w2-3/PPyϬ>!M͑.0N3nm%"lzdN;)h0Fv}d3mU!)la v[8"=nM Z rqlw`Ù@q.ݮIL)LWޓ+n*~d9(E݇uZQ (:a}ۛRVKE1o/]XPrAyR ɣ Gvj L1(N-<1^닿[SLio9Y FvjzHb 5~MOVu03T(\%jYrtר.M/ؕԌN3 ňOKH<bEşOJUo3T16#bqsWB! .0~|UWғa-ľ8:Jur^cfCDHf_S`_ fq =(u"(0vIQ1F'#}#`.?ğ5z).>eS-V:CW-r)q-"a6]-BD_JG3vSD>3 ê@+K!9YfA#%^žɀ^f~#hSzPjgQQ3b[b5T} ʱk/hU2O'{ݨr|Oft{A9+1V! M̩->V0Asԛ0e\^ڗ%kg5, Uc2ZчYm, .M-_ZyS?!p'[eyI莄35/ț|_ 1}_ž#G|Us$j8faGiq 6K92fK]xA|WXjae1!zm~O_qU[tbԇ;27g4̊5-sO1CPڗ[Pwɻ[ ݝ@@PRnl'=~e0}TuNM˞`VfPe i_zdl𗀤x#x ROil!%éĦ~f"5AfjYT i'CBI#>=b(UFFj73@GnW7{}ђ\nqtɫ$;dg",-3U)B1M_aIfcJYJ^pgnzp$@Ze:?M􀅯KlΥ9h>E*8O"C$;1#zn1"+sisRZ7Rq-HIaěVD&fI뚽roMNJ]gON(n*,/+=Z't 顚2ϖExBtqLk_,eS34}>98|;Ju EarK|j*2?nfbx v-5먂n+a?d.A'׈Xy\/8Wfi?))?W8nuk[ۯUضEK'{HzoSQST/H; WeGgBӡbȯK[14Dnzog/G@5lZh`e8By2/Bm7b\w75q-< uC/aaDKƵ4w] %3]} t;UO(Ν'# G&[igGAFgz ݦ#jZYaQ!9r=nȵQh> /7.Δ: LڗÃ\}/e|P1 jZhƞϊu 9PWŮ՜YDyn{M~lmVP΍,hP h#nЩKYD4Ղ~;c6m*\ $֓$k˰לeRTL&Z)0ӺD~3[Jw9h[t:ge=B@hkP0.+.Il;޾ZWs3zEq2o1 hD`6rk~*Rf+ĴJT>zq *{kO{A`^L+߶RAYcf[m  q6}]vfJbdĀ.b+AggƘP+}hj p aۖ 1縪cRYIiw ӏRMpflW6lX&` //Z7' $=,΀\=fS"=3 rsLݪEfSo2_?KJUŨfem|En0ÿF ﱾe\S`}%Gɉde}°u>1} # :۴|EFL86*zD Z~ݥɊ鉆a6ZÒ./zZV,2g] kn5w;6wHi36-1 V3n% *u5UWӼw- 1Q2CMm h%{mJԮ*hY*4Lȗ)J>H虽.T? ,mk 4K@t?\ xL+DGN"˶|S3h+eQw%چs1HˆuUmM뮳#ITZ5:jd?},k3Ol S[^da;H'camk k$hkC0Ws/ ^ L(!ڂ3^Ovs.B+}{`Y!lfl.a][w2f JyIfxۆF&| ~)qԄ88ʌn a0'),;LҔ$i%a\?α=Yy8Je]qܝK㗯vEhPm?ʹ +Wn`hձ|$ZH[~HpgՌ"-V,wtaX1QM?/]NF6O;~2`{g65dPh2ErbhVقIEn*8x#HK[ ˧xX́j2Is-R!8l;}S!^=𠄲+njgVwYOvJ\}(5O@7EK',Y͙޵b֎ wP7`RCy/]<7[ 0Ԥ=j6ԭT νU?{%0Hfڤ"v{Qvwf/L(0iyY䊳P$8 &O}'5ƛ;k*P:i>IgmLV̿N%J \leWm<=D4g5zD~6{.3u˷q=XiCyƶx)w] %Ǐm EVIXGFÝ=H7yX C<Ҡ\ʻ$:8jTdA߈ O·7v_ ?̵}Q|܉i}PaE1,ATg;( [ {Wɹt\c-m~nfqDjUrr"=p(R`z6c,p"KabsKsIBtycMCٔEXXKg2TsM~40i }H1t#n5*,Ӥ~sXp9Cxf&![d5~k0L5Z80_+JI_LB_ #7BCAvo$^X_VHei1o:RĔ1$ԚŸls2oNڂ5f-XawrAW2tYs)Jg2#8%%.V}Ȟɿ8hC ı`XXAwƞtIktL33X}ُ JPҳn쾂"v GG@Dl $$;h0vďirhj˜54%TfWEhpR3B\k 3{9‘?bvy*_)afd  ƆRc`bpCnsH{r`WdxMXB-3x _,kL_q=WOg4O'mcxM,LgWQ ~qNۤ@ \{`͛G 1`hߚ6[M#KBaoiDd=E 潈zX/hI&Z DF\.yZ&ig%UV/Nd'ɵD) { (k]bhX8 ]0Gw}«eirTs7vŹu[c}ٱd Z^;Q0oFVX%0ٹ !P̝\XyA ).H7N.\|3!f'8So;zx]ϗC̕ژ |C6ľWy"M3:Xz[F9K )Ԕ23M5r0m [)@ \W ez ؘݎyS]{^mDTBGD$X@ʵW¤2p{GKR^Ia[,QjƌʄM2.4XL9 73gߓf j U0U2wt2{a`mrTE-^wc4(+oQSp^=nE`"T.ywŏתb{6 v>OOzqDLɹ)v 5Ik֐5 QeIg79Ԡ/+]VA"Y,Za ^V*kv% S:HF|`D}"BBY]8:AEHP(G#b]{l&5}SO2<G+S+HG0 NX f~4o_Wwn6؃BR77$}K-^/%a:7 ;;JlxzLɛNx^5e&(!3W%'5\\ M1yȧ0J4 H(ЁnHa ψ!* ,yE: xt#mu%N7̒MO/-2K!m'u*etSw|$]|mVӕJ*x%+[e-x'^.~/abf Sg W+J"! VyVsy 7"GuZ8G0e(pg@zUD\$Z~]MdEIx,0zE+zO-I>DF!pLU;iS6Fig5^:uLqW#6^ siA:QUtVG /)@wru8V$h_zfv7+c7mŹĴzH̄ζ sw$g7Jܔ˳C9Na%p`'?P㄁K0Cw. Mf of >2?='ƂEuKx (J &TkԳ#m76ؼ FE4k|^/OS]+= ͻ!gEA//frtkv/-.Wνk p[X+X &b\!+p+z^X:>2ʼn(J&jsza7e<ЊݿP9c8g{! A_wSۺKWҢO6!@8e|c#ުOdBJO X RgQT>1q&XPaUcJq zIl܎1UZرtUN{GOAL.w 6d[IhsIzň.?X(N,.c*Ѩ ?=X?"fc SHDzAW?N4a3G,ERz6@:e8w0ӛ?^MGs)l y !{"G6^Uh`c%mxygP朢fq7$7d:vQ-5~LP僰D+)Z8릫KGuĠndޱBQڈ9Z[3\tȅ 1$lCCJ'?)ى`wP#,_÷tj>Feky_mVCBFɓl @nD{RBԑ+%9B$݋YXʙSo )y:Z :NFwveO 0Jj5(~vKwq0Ö'F~3KYMJ9,C P~@z7TDfhK_y#ΧlޔܛwdPuZ{v 7=NXk\[ $aL{O6rDRg wyt|Gscō(WH,jIF`)&?;G)ʲ7-є|uxW}˧mO6?7SW+ehTB"S\M,f]pԛz{n\xxQjQ7oHGpbv ,I֭2BɞlI=yÉCb2U3+F4Cp+i4jNQB\#ϝj8sAjտ޶H^=Uʥ^L,Cxk,;#,*4eОfHJ]JmM\W /DG!׹__Ofʗ;L#m@\RV`W6ܞѷ u-G3&൐O(("2f݁YٞKvσ40Ai&ͨZ'ڥ0q Iɍ~il.[≮hfCH ^p˦tz˛qP(rmr5:t28!;88cʽ{[rp5&6Fu6%oS IE1+Ø^!YAI",tw aP3Ye wC?.1ZV¢.׏&-U 9WGڿ-RZSM^ǔ+|M`#;êC/kKFt@\}{ c0D4˅Pϯ}`6GܶY}j_ AV{ih9t1C4$6Sk75,1_%dW]-LUiT -kLuZ J.`s#aNn>wD/TD3s]G͌Lwy >)XnLb&L{ DQ)`ᵟW']x}Ե򷆄!\.LfXv<Rcw8oV틳zٙSBsHypƑ>~}1{šN>$vXAb4CN7"YOg;-V2u"}\Q)Y|4k\Z`3"(MxZ"QG˼^ .^N:<.z Qꖁ7Ю&?].˜CۻtQtn*;enKDPZ.TTCJ+梼8}Ɖ:$98Ͷ#1#Jڋ WY|| 9&`Rfm-RS5+bht0o JhtN|,n˧s)2 Țu,%>9YgT(n'*2L<6)70>S0.4 *l1(n1^ˌ6ޡV\ʻE{@i=UxBZSv+\Ih$j. $С-٣ޥKF2@2qFw,Y&1 S1xɸjEEW,5JA?ޜ@0l.av~3t O=c Xl2k7gc*7CS,zGWɻS/!Il5;erm%l?^2# 0#4@t]!x6g=1 nH_P0te5_ID{T&LLG>Jx6pPNe/:k'í*G}oxu09@3*N3=nᨥR%z3@,=a>Pη#uV]IBdYp@~c_xtԚ>V)CĸV zA)GP˖m)ʑZ~6T ?9K9_qKzuGLJc8<|8 w&[q=G*fb fcBs})ɴ'>٨c#( Ȧ*ǽ4A  $(ףF c)T#ڼT2Лq;kb%qi:c&U82$\HVMYzrc 7b1)@ H̸*%B8qX j|7:&p?BY=D Sмb;HC O]HxcFI"n(%d֐rێ?$?p)KgPK9f XGsqAa֧_+sӏ`%oʩ?0V'iu#P TTvXAũ~q|gxW&ȃ&IQBz7N_؅S&Y܍yԳ/(=Z|jϏ 7Ygf_a qQ;O(nFXNAו$+qGXT( ='cI ,d\)SA j9_@e6c GA}h\zS3߳rfJ3&7^R撮dސ{ 71-#4 0YsS lt Cn{#qP߷A#cypFHp'zxL_2 #o{vrHV:p,%y BoWe?N`4sUp4k gaVqt*@ ^D}DE xbvj^eb)Yy9śK2i, .^ּi%˩@L .yjmn`A?4J-5?̸îLgv3w f1FXs$ zޮrG1xr[ A:wF?GY07'? Zv*# }$f 1rńXwk)E|GbCi_'<='B2է|Ur+ /Bhu)d}ҫlBڑ9,r pi;!uu^:; x6fA{?u˭99 XTlRr_(0έ$Bχˀ_&3C(U:'>* MG}>U.a·^qaʔCc93%;–/1΁Aev{sA!|n:UueBK-* 4ew<|L~j[(W-MT`fuLztzJtYI<^&[tjW/#N)).?_Ӥor, 39ǁEdw)RQIXqX_;jGiN_m;tcj:S2PvֽziFF+'yڨɋVTcGPS^6"6.~̾pX?x솗!v)?\U @M&\! lÿ+QkWhM7k]%'ᮻ.Qa[Az$KE_þ'W٧$HC>}Cw#O.IJm5pz Z6i≍c%9ߋICuxt +L/nN} ') YKXY)ew 3ϮqZp,6v`7QcZIS”wgBߙ+e5E -0ڄaJVFd+ Q*bq)6VQ6P$s H`^뀡;_ۭ]2+f8@}@8;?uB%  TJ`uRwZڋi3ם1+cWOYVҊ֕O7.ǭi3GÄ~BFѶEfp!>FґY(눊F*=ts [dB!^m!3?/i?ڠxH9!/MUs}E欕w ;1(զrlq_1N@W Jԕ|Vh}g2㞔bmJ3ոW VXCs+ByŎ2 AͺXj5{vZ%gVb1֚ k,Oj wcoљ"0\Y'}[䑫Z+"gc[URBM޲' b\qbSQg8f$'#D+DkXQG@1M bI$)lU?`{Q~U= +E/Gx*/Ssi2GŲv&Lcl+|3z&}.̴Wo4J%9Rx{ǛZhDc ҭ6Zv*8]_of 0dSWQG#WM@4 ƸHŷk$N`&L;U,}v˔w¾儏gL'Θ:,{Ѥj>8dÄf`T d0 OI&=0HDhPO^-M̘ xj2mB \^X*'6+luU"V섁6|h(/K,fū13baW頼Ťpq5.SG i bvY@wO$\Y'IK.`xGDqṀBdz}裰5iӄM@nx쬦TsB5qTR)M:mť6ӕq68iDF_BZ9IYP!e468on0)?n7=HX^UpLYů:!c{ZGebi5/26k}xצJ<6PgC! k[nsW09,ٴJ?@E:fN_f [~%зck>8Lb~D)ۏ > )׉=<#gRX\e+=_pWMFDp22ZRkXcRz\|kނEs$I3C=5}y\#v0|W4/;H¶1E |~;3ĵQg,a'^ɥmV^ JSIF>6H5̀i(lezwKbH yj" Ƈ5#aJHSOgُ;Mc6 Hʂ󍜻+>5pL@KRm"h]SF,h$`8DZjJhO}JB}8Qbiw݇Oǘs[+)`MzmJDB: wd1Ml czx h}fSb Zleê? 8<HN_vĺ+tۭH+ !Ib0XF>QL{K8Fgfe/1dߙiک ."!,+>`1njYa'Q'q&P(u6s]K}7Y9'uMA )p#G}&Hhb] 뢈~ޤ@bg5މo M8S"C%9`!8`[X)b#vxf3}{HuHd*5LOܓ6N̓EV+F%%/c>f Dz&'*Ŧ<Ѓͷ3,+Φ| lK䠭W9 Vb,|N\w }x#|#/ZiD sPmm\ǯW\ 劰ېep|ȴ1gbtDؚB^#U <&%cNK,\|d!!y/#;^Y2AJ<5V]BH:ی|ߐ ,xٺUӯ,6}>؋șAe: iXyN5yJ`;w{US~2oLxY`Ghp]mDWâ*c<32kxbx y%U^FݠhGc:G}'Gu mў3йv%E 4ƥǵ+Ŭ߄h&]՜zl8(DQOVYL -v4rm&*fz0-иJʵ` ea<) M~8]&kj"-g1oQ:MyKuC@oՂdTNHncѶ)54wzĥk"1&h >Ÿ 0jfdd} /`,Kr \zEI(I$1Cm8p,*[U@4 o91 )'濺n&Ph`') -ב6`!`Mi<ឮHd-"o! dSG!]CK9$MФZ%WU?Rk,CphLO83ӈ}wMCEhn3+w^t zk\IόFZ(-H@nVš|`JNq]w-klBײ9UC/Ek)&E`OY;mP~nsU헃O E޲ {ͩ07ڧR<^t+!2\qo+# YqE:M\@LUa-J$^2'f{F(Udبv +o.T;|V%BTB~M߬DgD _@|ߵ *L1'eֳlB09"^,Y_)ACzP4nX%ل :lxSܲ3M"LW/Ȩ,w@'p9 ɰJkE/:دl}{KYD@ȥ䋻;GᮙqeNWD@{HFj`V^92$ٯD޷bkmS'aD~p]g 0a2bc"5,Eg1 M<!Q4v )akжm. !U5ągW (Bc2Mnny\hn8}v>Efض/jH_P9aXk"gYN0 ]~lfɤbO( Wݫ ^BM_ɓHbƝ+;yV"9yb#t!Ahrw],F'a}T`O҈ɖF4 4mB$:_$,;"^\:j7>F"`a4N]@g[޲w$46Qhi'6Ã;&!XVHђ>2Z.I/2U] |#/g|htͿ,xWmUAuAsċjsХk9tC†u3,ؤ:s^xL%JW?ӡ^v1>z>4GyleuM0jmp3V 洛R"K 4=xb_s RolgYSF} JRdt >;GԥkYeϖ?.Q.a ^QY=c{~{!RQEUeO&7ucm[7F ,(?~Ex+}M.#'Ck! N'IyXp$Pԉ''ChO~>m))ˢ0>LWQ:QaJr6ѕ.z,7zw- a^` >;EvQXcuf#s95T*d3+@KGkxizEv,$ 1oncچxu Rm6v[}"aYF%p:#xZ%jhi=kƈUyL8K؟`ڜk/Xl#]Qi8V:ml^zCnGuJSN~y<u՝j FrP^]`;)TE`W; 7Pa1tf!_67<`Rֻڂ9oONZvtƀxC^{J|9*/+PW w V"5ź6̨\O҃DaQj;iEJ7 z.c׋'j7{"n 6gԿ8225? >kQX^mreoS=!1p/n>J!'2v7^fvTqܸ1O6KO2 :Hg2 f\'z|>xhNRΩ2nL3[I,G \ṱ]UX=\{+&ɗ9jP](KJ{&;ie95H3pG8҆C'`wЕ/a 1Um^PZkY;]*ӗܫB# ʤ몥E#p! geTZ'UҋgyŢez#; (!XH#G./ <ߣ5%B,6םM]VOR3iwcGgX\ : (8vNatgFH%hV%Ed/-R@viCչNkYT,B~"}LUv܎\~ 0,GeJ`Yr+9ZeG,U6S v\x? i:A|)CQD0| × ERلH@{@b k'쯝JC9#DDDT +Q2S?Q1YV8P k{0ҌCa&蟈JEy,ZO=ue[\ėǟ!@$b=Mkf2(tgLXIpJi݃{ H^S/^X:w#Ӄ4Y*Bbfpcux"4f_L) 7P!V4)^Po"'bri~]̈́ԑtj13G@$N,)t"iسrMiO Ƴ?w5J*MČ4~X8i:ƶ#&R7V~~myOhv|C>Z4|>ΒUJ8̈佂Qh@6&Q[JDT4MZ_+[˲ ZVs-ށ,n)t&BhFWXdYU)U1R=<>}$AsX%>Y+ޢz, 9x٘ Y(Y"_#Vr O;}|IMj{xJNIuBK,kxa@oYKNaEz(^d &jK4)'i[!%q\(q֡2 PKҥQK^ i JE ",/fVW=j 8ň^Wt$9-^%-!Pkg$ %  4Gb\dY8`;4F5E'kbpZ\Lx mHjWO_H2w,4Wd3+gڳ#H\Q#՞P $"VXH>8jWi/yDWh6%N5) (WkÁBUJ_xtAH¢7%G9 `#1,@6De^2!J+ڃ)~Q$q)^+zͳ upqY!Z2Ӧ禫2`?ѝo#s:/&nxA]Puq(n,3:xY_ϧFtL8'DĺWrm܍[cLaSx?yFpb{9,? -TT/w+Z1 NnL4k8̓LSRy|}ByML FP*A_/KF.5!g]tݠ? x5Zo d (ɡ / (fc22u9Rchk}82 r K$mO7bg[*"e*z,,L3}-ZUiIS)`ݧHvl遬kSJɶmWƌAנ'|?sB/5W;(9\Y Ʌj;XӋ>8Ûh4PT@݇3,z=q ]37q-WtUa : {ÝlB_Tݾh[4.R>;+$v; y*T.;F[T6ꇅ(E^%GƥBzpUbDٜ,~[9OVz"w krܣAC,iN&zkoyQ9oS4""b\Vz ʓe 3SYt$TnWe2h@qG\`{+MpjQJJw6 NEUq] {ߝ^;q~毈D'F1#x| Ћ;0_LzV1:mTq}}]<,PFr^.z{X M,MAFc]q# kM](2 R12Ao2~8 qOɁu?Gk0B$y$rSl#E?R_ W,챟F ?iwnoܤy^֗Q|/V g;#)`$Š֗JA>dK (R~GA96y~0DڝQ0wrnupOEd-YpmJ9掽}0*ץ)NyM#NjOp06j|Se!iޮQs)jОWT6al<z3a"jSǃBA|Y'8)e YZ