mariadb-client-10.6.20-150400.3.36.1<>,$gFp9|LTOfn,␖鷾߂p䶠Ca/V(tL~m |- N  גi@ly88Fq]Y;p4G#7Hf\,:{'H[ѹ%F;GmNjT%9(Փ/չtr8eц)㦋u6`4$Y$rP Ыb(7'H9P3񸯆atНa\ЋS5tIR|tif&+%FJ?Jd ' :tx 17>!@! ! ! H!  i!  ! l! !  ! d & `&j&(89: =9B9F9&G9<!H9!I:D!X:hY:Z:[:\:!];\!^=Eb=c>_d>e>f>l>u?!v?wF!xG!yHzJ0J@JDJJJCmariadb-client10.6.20150400.3.36.1Client for MariaDBThis package contains the standard clients for MariaDB.gFh01-ch4cEVSUSE Linux Enterprise 15SUSE LLC SUSE-GPL-2.0-with-FLOSS-exceptionhttps://www.suse.com/Productivity/Databases/Clientshttps://www.mariadb.orglinuxx86_64/usr/sbin/sysusers2shadow mysql-user.conf <<"EOF" || [ -f /.buildenv ] u mysql 60 "MySQL database admin" /var/lib/mysql EOF @X<<<7   Mh))(*($1>;c9zlAA큤gFgFgFgFgFgFgFgFgFкgFкgFкgFлgFкgFкgFкgFgFgFgFgFͽgFͽgFͽgFͽgFͽgFͽgFͽg +g +g +g +g +g +g +ff2618c4242f48e7a984cc0c95bbac507a4732f043e21f140a95cc87c26a093ae0764a7a0c4eb6527c4f4d0c69b8990b422a2fca30268d7e9305c142b7af73568a8a41bd5119eca1f5dbd01a8a703ea75fd09eb7e3db88aa00f0d3c57a03a3f0146aea581ad4434306fee9e5f6375c202a9cfbd283c2c9b47c2080904f06d5a23f27ed619e4d07517dba795188243c704f70ab5a9c574f4a97358ec5c35e267700a78a736b94dc2964a65b3c3cbecd3d0b7f5495bd3f679cf405aa1208f98bec1387cd7001377f4e847e8f1309e16fc3e50c26bc76e1fad0c4d791ea6ee2eb323a887cd38e6e43bccad02c2d3f8368c908995345824c0253a991d1203f1a648a3ca8ece4659a9e724f8ff4fa607797b31d9dd45af1aa1a508127c9d8b465cebaebed50445e28dc243081e3049fc2941426c401ab36a4e333b952f3d842eb3220e1be4318acaa2e00a39edf548e9d5ae129fa7f0dfb66ad1e63b824a6df9f03f44c2ccaa9faf36cf2867e67e2cdf1a1d8ebab0d285930b55da375ae964894a7eea7987e92c69f5547d59d33de9b4724121ceb65f3ff50c5bce5ae6b01fd0a80239c692557c1f2bd8f2e981cae9a934da46e5ac1cf8c57c728c51a53b107f334e71e18157e03db02c9b73c81ac192d173ff85a6847f601493f66f087b76855fe9032d683106781bedcbdca6c0398206fd74191991b8feb11568100b4eee81665e5e8dd90090149be367d766a5b7c37c56b305a14a4ac0429741138a026a3340b619784e7cacec5ba1a01c97bc87415744f7e81f9ed4b887bfd218a8b9716a85fda05268d19c4acdc9f98eaf0702871856e76349ef5591b154711652eda2c2f0a4eeacbe0ece8f6ed6c6b2cf3d162eaf45c991afa16a806b6c958767bb64d315d35a3208f5bddce11a58c0e8ee2ec9b6d08fbff015783aaaae441c1cf107776aca9445e4483c5431949abba32b67edbc39d111483bb488565ca54232d4308ad2bd63149d4658900193f2cd2e36ad457974fcaf53bc4ae8f3ccc9cd07b27f878e73c67b8c86b2814c58e58f0745019b3b9438018b9a21aa3936c49c8b734b7bd07f9mariadbmariadb-adminmariadb-checkmariadbd-safe-helpermariadb-dumpmariadb-importmariadb-showrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmariadb-10.6.20-150400.3.36.1.src.rpmconfig(mariadb-client)group(mysql)mariadb-clientmariadb-client(x86-64)mysql-clientuser(mysql)@@@@@@@@@@@@@@@@ @@@@@@@@@@@@@     /bin/shconfig(mariadb-client)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libedit.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libmariadb3libncurses.so.6()(64bit)libncurses.so.6(NCURSEST6_5.7.20081102)(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libssl.so.1.1(OPENSSL_1_1_1)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libz.so.1()(64bit)mariadb-errormessagesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysuser-shadow10.6.20-150400.3.36.13.010.6.203.0.4-14.6.0-14.0-15.2-13.2mysql-client4.14.3g(@fO/dddlcc*c @bkb'E@b @a@a@aKaKaW@aba@a~@a^@a]aHwa6a@aG```KW`*b@`@`@_ǁ_#__N7_N7_3_'@^y^א^^Ǿ^@^@^v^y@^V]^U @^U @^O@^=Q@^:@^9\^9\^6^*@^,]@]@]M@]@]p]L]J@]D%]D%]9]8H@]\]@\ڭ\N\@\v{\n\j@\f\eX@\b@\-@\@\w[@[G[t[Q@[9@[[ @[M@[WZ@Z@Z@ZZ@ZH@Z$ZZaZOhZKt@Z;@ZZ@Z@YeYeY@YYcl@Y-^X@X,XpXXbWXAb@X W]NW+5V@V\:@UM@U@U@U>U@UJ@U-@U-@U@U.@T@TPT7T@TT_W@antonio.teixeira@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comgmbr3@opensuse.orgdanilo.spinella@suse.comdanilo.spinella@suse.comsuse-beta@cboltz.dedanilo.spinella@suse.comjsegitz@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comrpm@fthiessen.dedimstar@opensuse.orgkstreitova@suse.comkstreitova@suse.commrueckert@suse.demrueckert@suse.demrueckert@suse.dekstreitova@suse.commarec@detebe.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgkstreitova@suse.comdimstar@opensuse.orgguillaume.gardet@opensuse.orgpgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comidonmez@suse.commliska@suse.czkukuk@suse.comschwab@suse.depgajdos@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comstefan.bruens@rwth-aachen.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.commliska@suse.czkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comsuse+build@de-korte.orgrick.salevsky@suse.comtbechtold@suse.comnicolas.bock@suse.comkstreitova@suse.comkstreitova@suse.comadrian.glaubitz@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkukuk@suse.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comro@suse.dersalevsky@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.orgkstreitova@suse.comrhafer@suse.devcizek@suse.comkstreitova@suse.comvcizek@suse.combwiedemann@suse.comvcizek@suse.comkstreitova@suse.comfvogt@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.org13ilya@gmail.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichal.hrusecky@opensuse.orgmichal.hrusecky@opensuse.orgdvaleev@suse.comsweet_f_a@gmx.demichal.hrusecky@opensuse.orgmgorse@suse.comxrigou@otenet.grxrigou@otenet.grmichal.hrusecky@opensuse.orgledest@gmail.com- Update to 10.6.20: https://mariadb.com/kb/en/mariadb-10-6-20-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-20-changelog/ https://mariadb.com/kb/en/mariadb-10-6-19-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-19-changelog/ * fixes for the following security vulnerabilities: 10.6.20: none 10.6.19: none - Update list of skipped tests- Update to 10.6.18: https://mariadb.com/kb/en/mariadb-10-6-18-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-18-changelog/ https://mariadb.com/kb/en/mariadb-10-6-17-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-17-changelog/ https://mariadb.com/kb/en/mariadb-10-6-16-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-16-changelog/ * fixes for the following security vulnerabilities: 10.6.18: CVE-2024-21096, bsc#1225983 10.6.17: none 10.6.16: CVE-2023-22084, bsc#1217405 - Refresh patches: * mariadb-10.2.4-fortify-and-O.patch * mariadb-10.2.4-logrotate.patch * mariadb-10.4.12-fix-install-db.patch - Update list of skipped tests- Update to 10.6.15: https://mariadb.com/kb/en/mariadb-10-6-15-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-15-changelog/ * fixes for the following security vulnerabilities: 10.6.15: none- Update to 10.6.14: https://mariadb.com/kb/en/mariadb-10-6-14-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-14-changelog/ * fixes for the following security vulnerabilities: 10.6.14: none- Update to 10.6.13: https://mariadb.com/kb/en/mariadb-10-6-13-release-notes/ https://mariadb.com/kb/en/mariadb-10-6-13-changelog/ * fixes for the following security vulnerabilities: 10.6.13: CVE-2022-47015 (bsc#1207404) - Update list of skipped tests- Update to 10.6.12: https://mariadb.com/kb/en/library/mariadb-10612-release-notes https://mariadb.com/kb/en/library/mariadb-10612-changelog https://mariadb.com/kb/en/library/mariadb-10611-release-notes https://mariadb.com/kb/en/library/mariadb-10611-changelog * fixes for the following security vulnerabilities: 10.6.12: none 10.6.11: none - Update mariadb.keyring - Update list of skipped tests- Update to 10.6.10: https://mariadb.com/kb/en/library/mariadb-10610-release-notes https://mariadb.com/kb/en/library/mariadb-10610-changelog * fixes for the following security vulnerabilities: 10.6.10: none- Update to 10.6.9: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1069-release-notes https://mariadb.com/kb/en/library/mariadb-1069-changelog * fixes for the following security vulnerabilities: 10.6.9: CVE-2022-32082 (bsc#1201162) CVE-2022-32089 (bsc#1201169) CVE-2022-32081 (bsc#1201161) CVE-2022-32091 (bsc#1201170) CVE-2022-32084 (bsc#1201164) CVE-2022-38791 (bsc#1202863) * The package is not affected by the following security vulnerabilities: CVE-2018-25032 (bsc#1197459) - Update mysql-systemd-helper to be aware of custom group, bsc#1200105 - Update list of skipped tests- Update to 10.6.8 (bsc#1199928): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1068-release-notes https://mariadb.com/kb/en/library/mariadb-1068-changelog * fixes for the following security vulnerabilities: 10.6.8: CVE-2021-46669 CVE-2022-27376 (bsc#1198628) CVE-2022-27377 (bsc#1198603) CVE-2022-27378 (bsc#1198604) CVE-2022-27379 (bsc#1198605) CVE-2022-27380 (bsc#1198606) CVE-2022-27381 (bsc#1198607) CVE-2022-27382 (bsc#1198609) CVE-2022-27383 (bsc#1198610) CVE-2022-27384 (bsc#1198611) CVE-2022-27386 (bsc#1198612) CVE-2022-27387 (bsc#1198613) CVE-2022-27444 (bsc#1198634) CVE-2022-27445 (bsc#1198629) CVE-2022-27446 (bsc#1198630) CVE-2022-27447 (bsc#1198631) CVE-2022-27448 (bsc#1198632) CVE-2022-27449 (bsc#1198633) CVE-2022-27451 (bsc#1198639) CVE-2022-27452 (bsc#1198640) CVE-2022-27455 (bsc#1198638) CVE-2022-27456 (bsc#1198635) CVE-2022-27457 (bsc#1198636) CVE-2022-27458 (bsc#1198637) CVE-2022-32088 (bsc#1201168) CVE-2022-32087 (bsc#1201167) CVE-2022-32086 (bsc#1201166) CVE-2022-32085 (bsc#1201165) CVE-2022-32083 (bsc#1201163) - Update list of skipped tests - The following issue is not affecting this package: * CVE-2022-21427- Build mariadb-galera on SLE (jsc#SLE-22245) - Add dependency on galera-4 for mariadb-galera - Remove old constraints for mariadb-galera- Update to 10.6.7 (bsc#1196016): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1067-release-notes https://mariadb.com/kb/en/library/mariadb-1067-changelog https://mariadb.com/kb/en/library/mariadb-1066-release-notes https://mariadb.com/kb/en/library/mariadb-1066-changelog * fixes for the following security vulnerabilities: 10.6.7: CVE-2021-46665 CVE-2021-46664 CVE-2021-46661 CVE-2021-46668 CVE-2021-46663 10.6.6: CVE-2022-24052 CVE-2022-24051 CVE-2022-24050 CVE-2022-24048 CVE-2021-46659, bsc#1195339 - Skip failing tests for s390x, fixes bsc#1195076 * suse_skipped_tests.list - Remove upstreamed patches: * mariadb-10.0.15-logrotate-su.patch * mariadb-10.1.1-mysqld_multi-features.patch - Refresh mariadb-10.2.4-logrotate.patch - The following issues have already been fixed in this package but weren't previously mentioned in the changes file: CVE-2021-46658, bsc#1195334 CVE-2021-46657, bsc#1195325- The following issues have already been fixed in this package but weren't previously mentioned in the changes file: bsc#1189320 CVE-2021-2154, bsc#1185872 CVE-2021-2166, bsc#1185870 CVE-2021-27928, bsc#1183770 MDEV-23851- Fix rpmlint errors - Run spec-cleaner- Enable LZ4 compression for INNODB and ROCKSDB, fixes bsc#1186031- Revert systemd hardening * Remove harden_mariadb.service.patch- Add CONFIG parameter to %sysusers_generate_pre- Update to 10.6.5 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1065-release-notes https://mariadb.com/kb/en/library/mariadb-1065-changelog * fixes for the following security vulnerabilities: 10.6.5: none - Not affected by [CVE-2021-35604], bsc#1192497 - Drop upstreamed patch: * mariadb-10.2.19-link-and-enable-c++11-atomics.patch- Use pam macros instead of hardcoding directories, fixes bsc#1191038 - Add fix-pamdir.patch- Add func_math_tests_MDEV-26645.diff to avoid test failures in the func_math test on Tumbleweed s390x and ppc64 until MDEV-26645 gets fixed upstream- Fix socket address in mariadb@.socket file- Added hardening to systemd service(s) (bsc#1181400). Added patch(es): * harden_mariadb.service.patch Modified: * mariadb.service.in- Replace %{_rpmconfigdir}/macros.d with %{_rpmmacrodir}, remove ownership of this directory. Fixes boo#1182218 - Run spec-cleaner- Update to 10.6.4 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1064-release-notes https://mariadb.com/kb/en/library/mariadb-1064-changelog https://mariadb.com/kb/en/library/mariadb-1063-release-notes https://mariadb.com/kb/en/library/mariadb-1063-changelog https://mariadb.com/kb/en/library/mariadb-1062-release-notes https://mariadb.com/kb/en/library/mariadb-1062-changelog https://mariadb.com/kb/en/library/mariadb-1061-release-notes https://mariadb.com/kb/en/library/mariadb-1061-changelog https://mariadb.com/kb/en/library/mariadb-1060-release-notes https://mariadb.com/kb/en/library/mariadb-1060-changelog * fixes for the following security vulnerabilities: 10.6.4: CVE-2021-2372 CVE-2021-2389 - Removed support to tokudb as it has been removed from upstream - Refresh mariadb-10.2.4-fortify-and-O.patch - Add new systemd socket from upstream- Support both rpmlint 1.x and 2.x.- Update rpmlint rules in order to work with rpmlint2 (bsc#1179049).- Update to version 10.5.10 * Fix CVE-2021-2154 * Add ST_DISTANCE_SPHERE for calculating the spherical distance between two geometries (point or multipoint) on a sphere * Fix: Crash with invalid multi-table update of view in 2nd execution of SP * Fix: Incorrect name resolution for subqueries in ON expressions * Fix: Complex query in Store procedure corrupts results * Fix: DELETE HISTORY may delete current data on system-versioned table * Fix: Crashes with nested table value constructors * Fix: Server crashes in thd_clear_errors() * Fix: The statement set password=password('') executed in PS mode fails in case it is run by a user with expired password * Full changes: https://mariadb.com/kb/en/mariadb-10510-changelog/ - Drop mariadb-10.5.9-cmake-3.20.patch, applied upstream- Add mariadb-10.5.9-cmake-3.20.patch: Fix syntax error which is exposed by cmake 3.20.- Update to 10.5.9 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1059-release-notes https://mariadb.com/kb/en/library/mariadb-1059-changelog * fixes for the following security vulnerabilities: 10.5.9: none - Tracker bug: [bsc#1182739] - Update fixes [bsc#1182255] (MDL BF-BF Conflict caused by TRUNCATE TABLE) - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - remove fix-lock-rollback-assert-abort.patch (applied upstream)- update the list of the skipped tests- exclude galera files if we build without this feature. - switch from 664 to 644 for my.cnf configuration file (probably a typo)- added fix-lock-rollback-assert-abort.patch fix an abort when a transaction is rolled back - track all patches in a series so we can easily set up a quilt tree without requiring all the devel packages- switch to bcond_with to make it easier to enable galera support via the prjconfig - fix non galera case for building- Update to 10.5.8 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1058-release-notes https://mariadb.com/kb/en/library/mariadb-1058-changelog * fixes for the following security vulnerabilities: 10.5.7: CVE-2020-14812, CVE-2020-14765, CVE-2020-14776, CVE-2020-14789 10.5.8: none - tracker bugs: [bsc#1177472] and [bsc#1178428] - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - update suse_skipped_tests.list- update to 10.5.6 * release notes and changelog https://mariadb.com/kb/en/mariadb-1056-release-notes https://mariadb.com/kb/en/mariadb-1056-changelog * fixes for the following security vulnerabilities: 10.5.6: CVE-2020-15180 < 10.5.6: none - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - drop mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch - mariadb now builds against pcre2 - added binaries aria_s3_copy and mariadb-conv to tools subpackage - added type_test.type_test_double to list of skipped tests- Using basic.target dependencies is not needed with any systemd release unless DefaultDependencies is disabled, remove from unit files- Mariadb uses hrtimers with absolute CLOCK_REALTIME values, this won't work correctly if the clock isn't set and will do funny things if it goes backward after starting the server as POSIX says that the new clock value shall influence them, start the service after time-sync.target to workaround the problem.- Update to 10.4.14 [bsc#1175596] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10414-release-notes https://mariadb.com/kb/en/library/mariadb-10414-changelog * fixes for the following security vulnerabilities: none * the update fixes [bsc#1174559] and [bsc#1173516] (MariaDB crashes at db_sync from Keystone) - refresh mariadb-10.2.4-fortify-and-O.patch - fix patch sequence - run spec-cleaner - build galera for openSUSE only - update suse_skipped_tests.list - tune the testsuite to avoid randomly failing tests- Fix installed .service files to follow the /usr/lib -> /usr/libexec move (boo#1174811).- Update _constraints to make it more readable and request more memory for aarch64 to avoid occasionnal OOM errors on %check- rpm macros: $TEST_USER identified by $TEST_PASS is actually user of the database for which client conf should be made for - rpm macros: database name or names can be specified as a %mysql_testserver_start and %mysql_testserver_cconf parameter - modified sources % macros.mariadb-test- Build with oqgraph by default for all codestreams [jsc#SLE-12253]- Update to 10.4.13 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10413-release-notes https://mariadb.com/kb/en/library/mariadb-10413-changelog * fixes for the following security vulnerabilities: CVE-2020-2752, CVE-2020-2812, CVE-2020-2814, CVE-2020-2760, CVE-2020-13249 - fixes [bsc#1168380] (the same as [bsc#1166781]) MDEV-21244 mysql_upgrade creating empty global_priv table support upgrades from 5.2 privilege tables - drop specfile "hacks" as things work correctly in upstream now: * renaming tmpfiles.conf -> mariadb.conf * installing pam_user_map.so to /lib64/security for non 32bit architectures * sysusers.conf was renamed to mariadb.conf - update suse_skipped_tests.list- move mariadb-client-test from client subpackage to test subpackage so the symlink from mariadb-client-test -> mysql_client_test works [bsc#1170204]- Add oqgraph.social to the suse_skipped_tests.list (reported upstream as MDEV-22280) [bsc#1169369]- Add -Wl,-Bsymbolic -Wl,-Bsymbolic-functions to linker flags so that symbols are resolved locally if possible, this will avoid https://bugs.kde.org/show_bug.cgi?id=391362- Add mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch in order to fix boo#1158405 (MDEV-21248).- Cleanup mysql user creation/handling and use sysusers.d- Bump disk constraint to 18Gb- test macros: clarify who is admin and user of the database, fix build with 10.4 - modified sources % macros.mariadb-test- remove @VERSION@ from mariadb.service and mariadb@.service- disable testing with rpm macros as it does not work as for 10.4, needs to be investigated- update suse_skipped_tests.list for ppc- rename mariadb.rpmlintrc to mariadb-rpmlintrc - for ppc install pam_user_map.so in /lib/security- rename mariadb-10.2.12-harden_setuid.patch to mariadb-10.4.12-harden_setuid.patch to match the correct version number. - add mariadb-10.4.12-fix-install-db.patch to improve default behaviour of mysql_install_db. This prevents performing security sensitive actions to be performed but instead only warns the caller (bsc#1160868).- update to 10.4.12 [jsc#SLE-8269] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10412-release-notes https://mariadb.com/kb/en/library/mariadb-10412-changelog https://mariadb.com/kb/en/library/mariadb-10411-release-notes https://mariadb.com/kb/en/library/mariadb-10411-changelog * fixes for the following security vulnerabilities: CVE-2020-2574 * don't let mysql_install_db set SUID bit for auth_pam_tool in rpm/deb packages CVE-2020-7221 [bsc#1160868] - add mariadb-10.2.12-harden_setuid.patch to harden auth_pam_tool setuid-root binary [bsc#1160285] - pack pam_user_map.so module in the /%{_lib}/security directory and user_map.conf configuration file in the /etc/security directory - fix race condition with mysql_upgrade_info status file by moving it to the location owned by root (/var/lib/misc) CVE-2019-18901 [bsc#1160895] - move .run-mysql_upgrade file from $datadir/.run-mysql_upgrade to /var/lib/misc/.mariadb_run_upgrade so the mysql user can't use it for a symlink attack [bsc#1160912] - change -DWITH_COMMENT and -DCOMPILATION_COMMENT to be SUSE/openSUSE independent- enhance mariadb.service and mariadb@.service with various options (Documentation=, User=, Group=, KillSignal=, SendSIGKILL=, Restart=, RestartSec=, CapabilityBoundingSet=, ProtectSystem=, ProtectHome=, PermissionsStartOnly= and UMask=) [bsc#1160878] - mysql-systemd-helper: use systemd-tmpfiles instead of shell script operations for a cleaner and safer creating of /run/mysql [bsc#1160883]- update to 10.4.10 * changes and improvements for 10.4 https://mariadb.com/kb/en/changes-improvements-in-mariadb-104/ * fixes for the following security vulnerabilities: none - pack mariadb variants of the mysql binaries (e.g. mariadb-dumpslow is a symlink to mysqldumpslow and the like) - refresh mariadb-10.2.4-fortify-and-O.patch - update suse_skipped_tests.list - _constraints: increase physicalmemory value - package auth_pam_tool setuid binary properly - add cracklib-password-check subpackage but do not build it right now (cracklib-dict-full >= 2.9.0 is not available yet) - add rcmariadb compat link - add mariadb.rpmlintrc file - do not move my_safe_process to bindir but use rpmlint arch-dependent-file-in-usr-share exception for it (this file is used just for the testing and it doesn't have to be in bindir- added rpm test macros: %mysql_testserver_start, %mysql_testserver_cconf, %mysql_testserver_stop First two consuments are python-sortinghat and python-mysqlclient.- update the list of the skipped tests- update to 10.3.20 * notable changes for 10.3.20 * MDEV-20987: InnoDB fails to start when FTS table has FK relation * notable changes for 10.3.19 * MDEV-20864: Debug-only option innodb_change_buffer_dump for dumping the contents of the InnoDB change buffer to the server error log at startup. * MariaBackup: * MDEV-18438: mbstream recreates xtrabackup_info on same directory as backup file * MDEV-20703: mariabackup creates binlog files in serve binlog directory on --prepare --export step * FULLTEXT INDEX: * MDEV-19647: Server hangs after dropping full text indexes and restart * MDEV-19529: InnoDB hang on DROP FULLTEXT INDEX * MDEV-19073: FTS row mismatch after crash recovery * MDEV-20621: FULLTEXT INDEX activity causes InnoDB hang * MDEV-20927: Duplicate key with auto increment * ALTER TABLE: * MDEV-20799: DROP Virtual Column crash * MDEV-20852: BtrBulk is unnecessarily holding dict_index_t::lock * System-Versioned Tables: * MDEV-16210: FK constraints on versioned tables use historical rows, which may cause constraint violation * MDEV-20812: Unexpected ER_ROW_IS_REFERENCED_2 or server crash in row_ins_foreign_report_err upon DELETE from versioned table with FK * Galera wsrep library updated to 25.3.28 * Fixes for the following security vulnerabilities: CVE-2019-2974, CVE-2019-2938 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10320-release-notes https://mariadb.com/kb/en/library/mariadb-10320-changelog https://mariadb.com/kb/en/library/mariadb-10319-release-notes https://mariadb.com/kb/en/library/mariadb-10319-changelog - remove mariadb-10.3.17-fix_ppc_build.patch (applied upstream) - refresh * mariadb-10.2.4-logrotate.patch * mariadb-10.0.15-logrotate-su.patch- update to 10.3.18 * notable changes * Connect updated to Connect 1.06.0010 * MDEV-20066: This bug could cause a table to become corrupt if a column was added instantly * MDEV-15326: A race condition in InnoDB transaction commit that affects record locking was fixed * MDEV-17187: Table doesn't exist in engine after ALTER of FOREIGN KEY * MDEV-20301: InnoDB's MVCC has O(N^2) behaviors * MDEV-18128: Simplify .ibd file creation * MDEV-20060: Failing assertion: srv_log_file_size <= 512ULL << 30 while preparing backup * MDEV-20247: Replication hangs with "preparing" and never starts * MDEV-17614: Remove unnecessary locking for INSERT...ON DUPLICATE KEY UPDATE * MDEV-20311: row_ins_step accesses uninitialized memory * MDEV-19947: Repositories for RHEL 8 ppc64le added * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10318-release-notes https://mariadb.com/kb/en/library/mariadb-10318-changelog- Use instead of for _constraints, increasing the worker pool on x86_64 from 6 to >700.- remove sql_mode from my.ini/my.cnf as NO_ENGINE_SUBSTITUTION and STRICT_TRANS_TABLES are already set by default from version 10.2.4 [bsc#1144314]- add mariadb-10.3.17-fix_ppc_build.patch to fix a compilation failure for ppc if ${CRC32_LIBRARY} target has no COMPILE_FLAGS yet. Then GET_TARGET_PROPERTY returns COMPILE_FLAGS-NOTFOUND, which doesn't work very well when it's later fed back into COMPILE_FLAGS. - _constraints: increase the memory because of the ppc build - adjust mysql-systemd-helper ("shutdown protected MySQL" section) so it checks both ping response and the pid in a process list as it can take some time till the process is terminated. Otherwise it can lead to "found left-over process" situation when regular mariadb is started [bsc#1143215]- update to 10.3.17 [bsc#1141798] * notable changes: * MDEV-19795: Merge upstream MyRocks. * MDEV-17228: Encrypted temporary tables are not encrypted. * MDEV-18328: Disks Plugin is now stable and requires the FILE privilege. * Merge relevant InnoDB changes from MySQL 5.7.27 * Adjust spin loops to the x86 PAUSE instruction latency * CREATE TABLE: MDEV-19292, MDEV-20102 * ALTER TABLE: MDEV-15641, MDEV-19630, MDEV-19916, MDEV-19974 * Indexed virtual columns: MDEV-16222, MDEV-17005, MDEV-19870 * FULLTEXT INDEX: MDEV-14154 * Encryption: MDEV-17228, MDEV-19914 * Galera + FOREIGN KEY: MDEV-19660 * Recovery & Mariabackup: MDEV-19978 * MDEV-19781: Add page id matching check in innochecksum tool * MDEV-20091: DROP TEMPORARY table is logged despite no CREATE was logged * MDEV-19427: mysql_upgrade_service throws exception upgrading from 10.0 to 10.3 * MDEV-19814: Server crash in row_upd_del_mark_clust_rec or Assertion * MDEV-17363: Compressed columns cannot be restored from dump * fixes for the following security vulnerabilities: CVE-2019-2805, CVE-2019-2740, CVE-2019-2739, CVE-2019-2737, CVE-2019-2758 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10317-release-notes https://mariadb.com/kb/en/library/mariadb-10317-changelog - add "BuildRequires: python3" as some tests and myrocks_hotbackup script need python3. Make the PYTHON_SHEBANG value configurable [bsc#1142909] - remove "innodb_file_format" option from my.ini (my.cnf) file that was removed in MariaDB 10.3.1. Also remove "innodb_file_per_table=ON" option that is by default ON and it's redundant now. - remove mariadb-10.2.9-galera_cnf.patch as it's not clear what the correct path to galera wsrep provider is while users can use galera 3, galera 4 or galera compiled on their own - add "Requires: python3-mysqlclient" that is needed by myrocks_hotbackup script- Use FAT LTO objects in order to provide proper static library.- remove client_ed25519.so plugin because it's shipped in mariadb-connector-c package (libmariadb_plugins)- removal of SuSEfirewall2 service, since SuSEfirewall2 has been replaced by firewalld, see [1]. [1]: https://lists.opensuse.org/opensuse-factory/2019-01/msg00490.html- update to 10.3.16 [bsc#1108088] * notable changes: * MDEV-19490: show tables fails when selecting the information_schema database * MDEV-19491: multi-update with triggers and stored routines * MDEV-19541: InnoDB crashes when trying to recover a corrupted page * MDEV-19725: Incorrect error handling in ALTER TABLE * MDEV-19445: FULLTEXT INDEX fix * MDEV-19486: System Versioning fix * MDEV-19509: InnoDB skips the tablespace in rotation list * MDEV-19614: SET GLOBAL innodb_ deadlock due to LOCK_global_system_variables * MDEV-17458: Unable to start galera node * MDEV-17456: Malicious SUPER user can possibly change audit log configuration without leaving traces * MDEV-19588: Wrong results from query, using left join * MDEV-19258: RIGHT JOIN hangs in MariaDB * Virtual columns fixes: MDEV-19027, MDEV-19602 * Crash recovery fixes: MDEV-13080, MDEV-19587, MDEV-19435 * MDEV-11094: Fixed row-based event applying with an error anymore when the events aim at the blackhole engine and row annotation is enabled * MDEV-19076: Fixed slave_parallel_mode=optimistic did not always properly order replication events on temporary tables in some case to attempt execution before a parent event has been already processed * MDEV-19158: Fixed duplicated entries in binlog occurred in combination of LOCK TABLES and binlog_format=MIXED when a being locked table was under replication unsafe operation * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10316-release-notes https://mariadb.com/kb/en/library/mariadb-10316-changelog - fix reading options for multiple instances if my${INSTANCE}.cnf is used. Also remove "umask 077" from mysql-systemd-helper that causes that new datadirs are created with wrong permissions. Set correct permissions for files created by us (mysql_upgrade_info, .run-mysql_upgrade) [bsc#1132666] - remove mariadb-5.5.28-install_db-quiet.patch and add "--rpm" option to the mysql_install_db script that does basically the same [bsc#1080891] - remove mariadb-10.1.12-deharcode-libdir.patch because it's not needed - we don't build libmariadb library in mariadb package anymore so we don't need to take care about LIBDIR and PLUGINDIR here. Moreover we shouldn't (and we don't) touch *_RPM variables as they are internal) [bsc#1080891] - update suse_skipped_tests.list- update to 10.3.15 * see changes in 10.3 series https://mariadb.com/kb/en/library/changes-improvements-in-mariadb-103/ * fixes for the following security vulnerabilities: [CVE-2019-2503] (the rest was already applied for 10.2) - remove mysql-community-server-5.1.45-multi-configuration.patch as we have the same configuration in /etc/my.cnf and it doesn't make any sense to keep it twice. Moreover the patched file support-files/my-medium.cnf.sh was removed in upstream - remove mariadb-5.2.3-cnf.patch as all patched files were removed upstream - refresh mariadb-10.2.4-fortify-and-O.patch - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch and use a simplified version from Debian - refresh README.install and suse-test-run - remove caching_sha2_password.so as it's shipped in mariadb-connector-c package (libmariadb_plugins) - rename libmysqld subpackage (embedded library) to libmariadbd as libmysqld.so was renamed to libmariadbd.so (MDEV-14953) - simplify removing static libs (we don't need to have .static) - add perl(Memoize) and perl(Symbol) to BuildRequires and Requires that are needed for tests - replace Requires pwdutils with shadow - build RocksDB only for x86_64 as other platforms are not supported - remove xtrabackup scripts as we already removed xtrabackup requires and it doesn't work for MariaDB 10.3 anyway - run spec-cleaner - tracker bugs for version updates in between: * 10.2.25 tracker bug [bsc#1136035] * 10.2.29 tracker bug [bsc#1156669]- update to 10.2.24 GA [bsc#1122198] * notable changes: * MDEV-18968 - Both (WHERE 0.1) and (WHERE NOT 0.1) return empty set * MDEV-18466 - Unsafe to log updates on tables referenced by foreign keys with triggers in statement format * MDEV-18899 - Server crashes in Field::set_warning_truncated_wrong_value * MDEV-18298 - Crashes server with segfault during role grants * MDEV-17610 - Unexpected connection abort after certain operations from within stored procedure * MDEV-19112 - WITH clause does not work with information_schema as default database * MDEV-17830 - Server crashes in Item_null_result::field_type upon SELECT with CHARSET(date) and ROLLUP * MDEV-14041 - Server crashes in String::length on queries with functions and ROLLUP * MDEV-18920 - Prepared statements with st_convexhull hang and eat 100% cpu. * MDEV-15837 - Assertion item1->type() == Item::FIELD_ITEM && item2->type() == Item::FIELD_ITEM * MDEV-9531 - GROUP_CONCAT with ORDER BY inside takes a lot of memory while it's executed * MDEV-17036 - BULK with replace doesn't take the first parameter in account * Bug#28986737 - RENAMING AND REPLACING MYSQL.USER TABLE CAN LEAD TO A SERVER CRASH * MDEV-19350 - Server crashes in delete_tree_element / ... / Item_func_group_concat::repack_tree * MDEV-19188 - Server Crash When Using a Trigger With A Number of Virtual Columns on INSERT/UPDATE * MDEV-19352 - Server crash in alloc_histograms_for_table_share upon query from information schema InnoDB * InnoDB persistent corruption fixes: MDEV-19426, MDEV-19022, MDEV-19241, MDEV-13942 * InnoDB recovery fixes and speedup: MDEV-18733, MDEV-12699, MDEV-19356, MDEV-19426 * MDEV-14398 - innodb_encrypt_tables will work even with innodb_encryption_rotate_key_age=0 * MDEV-17036 - BULK with replace doesn't take the first parameter in account * MDEV-14784 - Slave crashes in show_status_array upon running a trigger with select from I_S * MDEV-19060 - mariabackup continues, despite failing to open a tablespace * MDEV-18686 - Add option to PAM authentication plugin to allow case insensitive username matching * bugfix - multi-update checked privileges on views incorrectly * MDEV-19276 - during connect, write error log warning for ER_DBACCESS_DENIED_ERROR, if log_warnings > 1 * MDEV-17456 - Malicious SUPER user can possibly change audit log configuration without leaving traces. * fixes for the following security vulnerabilities: [CVE-2019-2614], [CVE-2019-2627], [CVE-2019-2628] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10224-release-notes https://mariadb.com/kb/en/library/mariadb-10224-changelog - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch- remove %{extra_provides} definition and Provides/Obsoletes where it was used. It's just a remnant and it's no longer needed.- update to 10.2.23 GA * notable changes: * InnoDB ALTER TABLE fixes: MDEV-18016, MDEV-18630, MDEV-18775, MDEV-18732, MDEV-18749, MDEV-18637, MDEV-13818, MDEV-17595 * MDEV-18878: InnoDB Purge: Optimize away futile table lookups * MDEV-14984: Regression in connect performance * MDEV-18936: Purge thread fails to exit on shutdown * MDEV-18272: InnoDB fails to rollback after exceeding FOREIGN KEY recursion depth * MDEV-9519: Data corruption on Galera cluster size change * MDEV-18204: fix incremental MyRocks backup * MDEV-18611: mariabackup terminated while copying InnoDB redo log * MDEV-18669: mariabackup writes timestamp in version line * MDEV-18855: Mariabackup should fetch innodb_compression_level from running server * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10223-release-notes https://mariadb.com/kb/en/library/mariadb-10223-changelog - remove mariadb-10.2.22-fix_path.patch that is no longer needed (applied upstream)- add mariadb-10.2.22-fix_path.patch to fix a path to resolveip in mysql_install_db script [bsc#1127027] MDEV-18526- my.cnf/my.ini: move slow_query_log example to the error log so it's logically together- fix references path below legacy directory /var/run -> /run- remove xtrabackup requirement as MariaDB ships a build in mariabackup so xtrabackup is not needed unless a user specificaly wants to use xtrabackup as sst method (also solves [bsc#1122475]- add slow_query_log example to my.cnf and adjust the logrotate configuration to rotate all /var/log/mysql/*.log files . This is useful when the slow query log is enabled. In that case, this log file should also be rotated (bsc#1112767)- update to 10.2.22 GA * notable changes: * Backport Information Schema CHECK_CONSTRAINTS Table. * MDEV-17475: Maximum value of table_definition_cache is now 2097152 * InnoDB ALTER TABLE fixes: MDEV-16499, MDEV-18186, MDEV-18237, MDEV-18222, MDEV-18256, MDEV-18016, MDEV-16849 * Mariabackup fixes: MDEV-18185, MDEV-18201, MDEV-18194 * Galera crash recovery fix: MDEV-15740 * Encryption fixes: MDEV-18129, MDEV-18183, MDEV-18279 * Fixes for the following security vulnerabilities: * CVE-2019-2510, CVE-2019-2537 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10222-release-notes https://mariadb.com/kb/en/library/mariadb-10222-changelog- update to 10.2.21 GA * notable changes: * MDEV-17589 - Stack-buffer-overflow with indexed varchar (utf8) field * MDEV-16987 - ALTER DATABASE possible in read-only mode (forbid ALTER DATABASE in read_only) * MDEV-17720 - slave_ddl_exec_mode=IDEMPOTENT does not handle DROP DATABASE * MDEV-6453 - Assertion `inited==NONE || (inited==RND && scan)' failed in handler::ha_rnd_init(bool) with InnoDB, joins, AND/OR conditions * MDEV-18105 - Mariabackup fails to copy encrypted InnoDB system tablespace if LSN>4G * MDEV-18041 - Database corruption after renaming a prefix-indexed column [bsc#1120041] * MDEV-17470 - Orphan temporary files after interrupted ALTER cause InnoDB: Operating system error number 17 and eventual fatal error 71 * MDEV-17833: ALTER TABLE is not enforcing prefix index size limit * MDEV-17989: InnoDB: Failing assertion: dict_tf2_is_valid(flags, flags2) * MDEV-17765: Locking bug fix for SPATIAL INDEX * MDEV-17923, MDEV-17904, MDEV-17938: Fixes for FULLTEXT INDEX * Fixes for regressions introduced in MariaDB Server 10.2.19 by the backup-safe TRUNCATE TABLE (MDEV-13564, innodb_safe_truncate=ON) and innodb_undo_log_truncate: * MDEV-17780, MDEV-17816, MDEV-17849, MDEV-17851, MDEV-17885 * Several improvements to MariaDB Server and backup for dealing with encrypted or page_compressed pages: * MDEV-12112: corruption in encrypted table may be overlooked * MDEV-17958: On little-endian systems, remove bug-compatible variant of innodb_checksum_algorithm=crc32 * MDEV-17957: Make innodb_checksum_algorithm stricter for strict_* values * MDEV-18025: Mariabackup fails to detect corrupted page_compressed=1 tables * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10221-release-notes https://mariadb.com/kb/en/library/mariadb-10221-changelog https://mariadb.com/kb/en/library/mariadb-10220-release-notes https://mariadb.com/kb/en/library/mariadb-10220-changelog - update suse_skipped_tests.list- remove PerconaFT from the package as it has AGPL licence [bsc#1118754] - use a new syntax for cmake variables that specify which plugin will be built- Add patch to link against libatomic where necessary and use C++11 atomics instead of gcc built-in atomics * mariadb-10.2.19-link-and-enable-c++11-atomics.patch - Add two tests to suse_skipped_tests.list for ppc * encryption.innodb-bad-key-change2 * encryption.innodb-bad-key-change4- update to 10.2.19 GA [bsc#1116686] * notable changes: * innodb_safe_truncate system variable for a backup-safe TRUNCATE TABLE implementation that is based on RENAME, CREATE, DROP (MDEV-14717, MDEV-14585, MDEV-13564). Default value for this variable is ON. If you absolutely must use XtraBackup instead of Mariabackup, you can set it to OFF and restart the server * MDEV-17289: Multi-pass recovery fails to apply some redo log records * MDEV-17073: INSERT…ON DUPLICATE KEY UPDATE became more deadlock-prone * MDEV-17491: micro optimize page_id_t * MDEV-13671: InnoDB should use case-insensitive column name comparisons like the rest of the server * Fixes for indexed virtual columns: MDEV-17215, MDEV-16980 * MDEV-17433: Allow InnoDB start up with empty ib_logfile0 from mariabackup --prepare * MDEV-12547: InnoDB FULLTEXT index has too strict innodb_ft_result_cache_limit max limit * MDEV-17541: KILL QUERY during lock wait in FOREIGN KEY check causes hang * MDEV-17531: Crash in RENAME TABLE with FOREIGN KEY and FULLTEXT INDEX * MDEV-17532: Performance_schema reports wrong directory for the temporary files of ALTER TABLE…ALGORITHM=INPLACE * MDEV-17545: Predicate lock for SPATIAL INDEX should lock non-matching record * MDEV-17546: SPATIAL INDEX should not be allowed for FOREIGN KEY * MDEV-17548: Incorrect access to off-page column for indexed virtual column * MDEV-12023: Assertion failure sym_node->table != NULL on startup * MDEV-17230: encryption_key_id from alter is ignored by encryption threads * fixes for the following security vulnerabilities: CVE-2018-3282 [bsc#1112432], CVE-2016-9843 [bsc#1013882], CVE-2018-3174 [bsc#1112368], CVE-2018-3143 [bsc#1112421], CVE-2018-3156 [bsc#1112417], CVE-2018-3251 [bsc#1112397], CVE-2018-3185 [bsc#1112384], CVE-2018-3277 [bsc#1112391], CVE-2018-3162 [bsc#1112415], CVE-2018-3173 [bsc#1112386], CVE-2018-3200 [bsc#1112404], CVE-2018-3284 [bsc#1112377] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10219-release-notes https://mariadb.com/kb/en/library/mariadb-10219-changelog - do not pack libmariadb.pc (packed in mariadb-connector-c)- add "Requires: libmariadb_plugins" to the mariadb-test subpackage in order to be able to test client plugins successfuly [bsc#1111859] - don't remove debug_key_management.so anymore [bsc#1111858]- update to 10.2.18 GA * notable changes: * MDEV-15511 - if available, stunnel can be used during Galera rsync SST * MDEV-16791 - mariabackup: Support DDL commands during backup * MDEV-13564 - Refuse MLOG_TRUNCATE in mariabackup * MDEV-16934 - add new system variable eq_range_index_dive_limit to speed up queries that new long nested IN lists. The default value, for backward compatibility, is 0 meaning "unlimited". * MDEV-13333 - errors on InnoDB lock conflict * Report all InnoDB redo log corruption * MDEV-17043 - Purge of indexed virtual columns may cause hang on table-rebuilding DDL * MDEV-16868 - corruption of InnoDB temporary tables * MDEV-16465 - Invalid (old?) table or database name or hang in ha_innobase::delete_table and log semaphore wait upon concurrent DDL with foreign keys * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10218-release-notes https://mariadb.com/kb/en/library/mariadb-10218-changelog - refresh mariadb-10.2.4-fortify-and-O.patch- add ssl tests that are failing with OpenSSL 1.1.1 to suse_skipped_tests.list [MDEV-17184]- update to 10.2.17 GA * notable changes: * New variable innodb_log_optimize_ddl for avoiding delay due to page flushing and allowing concurrent backup * InnoDB updated to 5.7.23 * MDEV-14637 - Fix hang due to DDL with FOREIGN KEY or persistent statistics * MDEV-15953 - Alter InnoDB Partitioned Table Moves Files (which were originally not in the datadir) to the datadir * MDEV-16515 - InnoDB: Failing assertion: ++retries < 10000 in file dict0dict.cc line 2737 * MDEV-16809 - Allow full redo logging for ALTER TABLE * Temporary tables: MDEV-16713 - InnoDB hang with repeating log entry * indexed virtual columns: MDEV-15855 - Deadlock between purge thread and DDL statement * MDEV-16664 - Change the default to innodb_lock_schedule_algorithm=fcfs * Galera: MDEV-15822 - WSREP: BF lock wait long for trx * fixes for the following security vulnerabilities: CVE-2018-3064 [bsc#1103342], CVE-2018-3063 [bsc#1101677], CVE-2018-3058 [bsc#1101676], CVE-2018-3066 [bsc#1101678], CVE-2018-3060 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10217-release-notes https://mariadb.com/kb/en/library/mariadb-10217-changelog- switch to libedit as control sequences were already fixed there so we don't have to avoid it [bsc#1098683]- update to 10.2.16 GA * notable changes: * MDEV-13122: mariabackup now supports MyRocks * MDEV-13779 - InnoDB fails to shut down purge workers, causing hang * MDEV-16267 - Wrong INFORMATION_SCHEMA.INNODB_BUFFER_PAGE.\ TABLE_NAME * MDEV-13834 - Upgrade failure from 10.1 innodb_encrypt_log * MDEV-16283 - ALTER TABLE...DISCARD TABLESPACE still takes long on a large buffer pool * MDEV-16376 - ASAN: heap-use-after-free in gcol.innodb_virtual_debug * MDEV-15824 - innodb_defragment=ON trumps innodb_optimize_fulltext_only=ON in OPTIMIZE TABLE * MDEV-16124 - fil_rename_tablespace() times out and crashes server during table-rebuilding ALTER TABLE * MDEV-16416 - Crash on IMPORT TABLESPACE of a ROW_FORMAT=COMPRESSED table * MDEV-16456 - InnoDB error "returned OS error 71" complains about wrong path * MDEV-13103 - Deal with page_compressed page corruption * MDEV-16496 - Mariabackup: Implement --verbose option to instrument InnoDB log apply * MDEV-16087 - Inconsistent SELECT results when query cache is enabled * MDEV-15114 - ASAN heap-use-after-free in mem_heap_dup or dfield_data_is_binary_equal (fix for indexed virtual columns) * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10216-release-notes https://mariadb.com/kb/en/library/mariadb-10216-changelog - refresh mariadb-5.5.28-install_db-quiet.patch - refresh mariadb-10.2.9-galera_cnf.patch - pack wsrep_sst_rsync_wan file to galera subpackage - update suse_skipped_tests.list- Don't require systemd explicit, spec file can handle both cases correct and in containers we don't have systemd.- update to 10.2.15 GA * notable changes: * PCRE updated to 8.42 * The embedded server library now supports SSL when connecting to remote servers [bsc#1088681], [CVE-2018-2767] * MDEV-15325 - Incomplete validation of missing tablespace during recovery * MDEV-15720 - ib_buffer_pool unnecessarily includes the temporary tablespace * MDEV-15764 - InnoDB may write uninitialized garbage to redo log * MDEV-15553 - Virtual Columns: Assertion failed in dict_table_get_col_name * MDEV-14705 - slow innodb startup/shutdown can exceed systemd timeout * MDEV-15507 - Assertion failed in dict_check_sys_tables on upgrade from 5.5 * MDEV-15916 - Change buffer crash during TRUNCATE or DROP TABLE * encryption fixes - MDEV-12632, MDEV-13516, MDEV-15752, MDEV-15566, MDEV-16092 * temporary table ROLLBACK fixes - MDEV-15826, MDEV-15374 * applicable changes from 5.7.22 - MDEV-16142 * fixes for the following security vulnerabilities: CVE-2018-2786, CVE-2018-2759, CVE-2018-2777, CVE-2018-2810, CVE-2018-2782, CVE-2018-2784, CVE-2018-2787, CVE-2018-2766, CVE-2018-2755, CVE-2018-2819, CVE-2018-2817, CVE-2018-2761, CVE-2018-2781, CVE-2018-2771, CVE-2018-2813 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10215-release-notes https://mariadb.com/kb/en/library/mariadb-10215-changelog - update suse_skipped_tests.list and add tests that are failing with GCC 8 [bsc#1092544], MDEV-16127 - do not build TokuDB as a build without jemalloc is not supported upstream- update suse_skipped_tests.list and add failing tests for s390- update to 10.2.14 GA * notable changes: * MyRocks is now Gamma (RC) * MDEV-14533 - Added the DISKS plugin, for monitoring disk space * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY. * MDEV-15333 - MariaDB (still) slow start * MDEV-12255 - Wrong result with innodb_prefix_index_cluster_optimization * MDEV-12396 - IMPORT TABLESPACE cleanup * MDEV-14648 - Restore fix for MySQL BUG#39053 - UNINSTALL PLUGIN does not allow the storage engine to cleanup open connections * MDEV-15249 - IMPORT fixes * MDEV-14988 - innodb_read_only tries to modify files if transactions were recovered in COMMITTED state * MDEV-14773 - DROP TABLE hangs for InnoDB table with FULLTEXT index (fixing a recent regression from upstream) * MDEV-15529 - IMPORT TABLESPACE unnecessarily uses the doublewrite buffer * MDEV-15554 - InnoDB page_cleaner shutdown sometimes hangs * MDEV-14545 - Mariabackup - Backup fails due to MLOG_INDEX_LOAD record * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10214-release-notes https://mariadb.com/kb/en/library/mariadb-10214-changelog - remove the following patches * mariadb-10.2.14-xtrabackup-v2.patch (applied upstream, MDEV-15254) * mariadb-10.2.13-aarch_compilefix.patch (applied upstream, MDEV-14318) * mariadb-10.2.10-disable_openssl_compatibility_check.patch (fixed upstream in https://github.com/MariaDB/server/pull/558) * mariadb-10.2.8-systemd-cmake.patch and DWITH_SYSTEMD=ON compile option that are no longer needed - systemd is detected correctly now (discussed in [bsc#1080891] and MDEV-8379) * mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch (fixed upstream in 52516706c86f9f66c76836eabde7e2477694bac3) * remove mariadb-10.2.3-group.patch that was just a half solution of the group support (missing server part) and moreover using a group option in mysql-systemd-helper was removed few years ago as it caused troubles because MariaDB resolved it as 'group_concat_max_len option' (see https://github.com/openSUSE/mysql-packaging/issues/15) - remove jar files from the tarball (used for testing from the source) - build TokuDB without the jemalloc support for now. Jemalloc 5 is not backwards compatible which leads to the errors in the testsuite at least (MDEV-15034) - update suse_skipped_tests.list- change %{extra_provides} macro from "mariadb_102" to "mariadb-102" and use this macro in Provides/Obsoletes for mariadb, test, tools, bench and errormessages subpackages to ensure a smooth transition from SLE12 to SLE15 [fate#323756] - remove "Provides: mariadb-errormessages = 10.1.25" that shouldn't be needed anymore- fix build on aarch64: compile a few more files with -O0 from https://jira.mariadb.org/browse/MDEV-14318 add patch mariadb-10.2.13-aarch_compilefix.patch- add mariadb-10.2.14-xtrabackup-v2.patch (bsc#1083087)- update to 10.2.13 GA * notable changes * InnoDB updated to 5.7.21 * Galera wsrep library updated to 25.3.23 * MDEV-13869 - MariaDB slow start * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY * MDEV-15249 - Crash in MVCC read after IMPORT TABLESPACE * Foreign key bugs: * MDEV-15199 - Referential integrity broken in ON DELETE CASCADE/MDEV-14222 Unnecessary 'cascade' memory allocation for every updated row * MDEV-15219 - FOREIGN KEY CASCADE or SET NULL operations will not resume after lock wait * MDEV-15042 - INSERT ON DUPLICATE KEY UPDATE produces error 1032 (Can't find record) * MDEV-13205 - InnoDB: Failing assertion: !dict_index_is_online_ddl(index) upon ALTER TABLE * MDEV-14958 - Merge new release of InnoDB MySQL 5.7.21 to 10.2 * MDEV-15165 - InnoDB purge for index on virtual column is trying to access an incomplete record * MDEV-15143 - InnoDB: Rollback of trx with id 0 completed * MDEV-11415 - Remove excessive undo logging during ALTER TABLE…ALGORITHM=COPY * MDEV-15016 - multiple page cleaner threads use a lot of CPU * MDEV-14941 - Timeouts on persistent statistics tables caused by MDEV-14511 * MDEV-14985 - innodb_undo_log_truncate may be blocked if transactions were recovered at startup * MDEV-14441 - InnoDB hangs when setting innodb_adaptive_hash_index=OFF during UPDATE * MDEV-14887 - On a 32-bit system, MariaDB 10.2 mishandles data file sizes exceeding 4GiB * fixes for the following security vulnerabilities: * CVE-2018-2562, CVE-2018-2622, CVE-2018-2640, CVE-2018-2665, CVE-2018-2668, CVE-2018-2612 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10213-release-notes/ https://mariadb.com/kb/en/library/mariadb-10213-changelog/ * fixes [bsc#1058729] and [bsc#1068906] - refresh mariadb-10.2.10-disable_openssl_compatibility_check.patch - refresh mariadb-10.2.3-group.patch- add dependency on which for galera scripts- change owner of mysql-test directory from root to mysql. It also fixes sys_vars.secure_file_priv running under mysql user (e.g. if ít's started via suse-test-run script) that needs to be able to create a test file there during its run [bsc#1012075]- update to 10.2.12 GA * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10212-release-notes/ https://mariadb.com/kb/en/library/mariadb-10212-changelog/ - remove mysql-community-server-5.5.6-safe-process-in-bin.patch becuase this moving is done in the specfile - get rid of the archive with patches (remove mysql-patches.tar.xz and series files), handle patches in the standard way mysql-community-server-5.1.45-multi-configuration.patch mariadb-10.2.4-logrotate.patch mariadb-5.5.28-install_db-quiet.patch mariadb-10.1.1-mysqld_multi-features.patch mariadb-5.2.3-cnf.patch mariadb-10.2.3-group.patch mariadb-10.1.12-deharcode-libdir.patch mariadb-10.0.15-logrotate-su.patch mariadb-10.2.4-fortify-and-O.patch mariadb-10.2.8-systemd-cmake.patch mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch mariadb-10.2.9-galera_cnf.patch mariadb-10.2.10-disable_openssl_compatibility_check.patch - add comments to the section with removing unused files (based on https://lists.launchpad.net/maria-developers/msg11028.html) - put rm statements together - install the new upstream systemd-tmpfiles configuration file 'tmpfiles.conf' and rename it to 'mariadb.conf' in order to follow the manual - remove the new upstream systemd-sysusers configuration file as we handle creating of mysql user in the specfile - mysql.service: remove calling of the wait function and let systemd to do this job. Switch from 'Type=simple' to 'Type=notify' and add TimeoutSec=300 - rename unit files from mysql to mariadb and add mysql alias for the backward compatibility [bsc#1067443] * mysql.service -> mariadb.service * mysql.target -> mariadb.target * mysql@.service -> mariadb@.service - remove configuration-tweaks.tar.xz and move configuration to my.ini/my.cnf file (omit default_plugins.cnf as all configuration here was commented out) - add a numeric prefix for galera.cnf file in order to allow users to speficy in which order the configs will be loaded within the my.cnf.d directory [bsc#1055268] - add 'bind-address = 127.0.0.1' as a default option to my.cnf file for security reasons (disable MariaDB to listen for TCP/IP connections by default) [bsc#1058374] - update my.cnf file and add a section with SSL configuration [bsc#1058374]- switch from deprecated 'net-tools' to 'iproute2' for mariadb-galera subpackage. This dependency switch is sufficient for making wsrep_sst_rsync.sh script to use 'ip' instead of 'ifconfig' command- Do not manually delete %{_localstatedir}/adm/update-messages/%{name}-%{version}-%{release}-something: The file is listed as ghost and thus properly owned by the package. - Use %tmpfiles_create which can cope with transactional updates.- update to 10.2.11 GA * release notes and changelog: * https://mariadb.com/kb/en/library/mariadb-10211-release-notes/ * https://mariadb.com/kb/en/library/mariadb-10211-changelog/ - pack additional mroonga/groonga files - change default charset to utf8mb4 for full Unicode support [fate#324329] - remove mariadb-10.2.10-wsrep_sst_common.patch as it's no longer needed- Added mariadb-10.2.10-wsrep_sst_common.patch (bsc#1069401). Upstream bug: https://jira.mariadb.org/browse/MDEV-14256- Disable openssl compatibility checking * the check uses CRYPTO_set_mem_functions() to set debugging memory allocation function. The setting only succeeds if no allocation was done before. Our fips self-tests, which are run from the library constructor, however, do allocate memory, so the subsequent call to CRYPTO_set_mem_functions causes the compatibility check to fail * add mariadb-10.2.10-disable_openssl_compatibility_check.patch- update to 10.2.10 GA * release notes and changelogs https://downloads.mariadb.org/mariadb/+releases/ * fixes for the following security vulnerabilities * 10.2.10: CVE-2017-10378, CVE-2017-10268, CVE-2017-15365 * 10.2.8: CVE-2017-3636, CVE-2017-3641, CVE-2017-3653, CVE-2017-10320, CVE-2017-10365, CVE-2017-10379, CVE-2017-10384, CVE-2017-10286, CVE-2017-3257 * 10.2.6: CVE-2017-3308, CVE-2017-3309, CVE-2017-3453, CVE-2017-3456, CVE-2017-3464 * 10.2.5: CVE-2017-3313, CVE-2017-3302 * [bsc#1042632], [bsc#1043328], [bsc#1019948], [fate#323738] - refresh and rename the following patches: * mariadb-10.1.4-group.patch to mariadb-10.2.3-group.patch * mariadb-10.1.16-systemd-cmake.patch to mariadb-10.2.8-systemd-cmake.patch * mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch * mariadb-10.1.12-fortify-and-O.patch to mariadb-10.2.4-fortify-and-O.patch * mysql-community-server-5.1.46-logrotate.patch to mariadb-10.2.4-logrotate.patch - add mariadb-10.2.10.tar.gz.sig signature and mariadb.keyring files - start building without client library part, use mariadb-connector-c for getting libmariadb libraries. Remove libmysclient* packages - remove baselibs.conf because we no longer build client libraries here - update %{soname} to 19 (libmysqld soname) - change '=' to '>=' in Requires:mariadb-errormessages for libmysqld%{soname}. Versioned libraries shouldn't require regular packages with '='. It also causes problems during update (Problem: libmysqld18-10.1.25-3.1.x86_64 requires mariadb-errormessages = 10.1.25, but this requirement cannot be provided). Also add "Provides: mariadb-errormessages = 10.1.25" for errormessages subpackage that solves this problem for the current update. - pack new files, remove mysql specific files - remove README.SUSE as it was outdated - package cleaning * run spec-cleaner * renumber sources * reorganize subpackages order and update summaries, descriptions and groups * tweak and add some comments to the specfile * remove warning about mysql-packaging repository that is no longer used for this package * remove checks whether we build mysql or mariadb (we build mariadb only) - add galera subpackage * add missing "Requires:" (lsof, net-tools, rsync, socat, xtrabackup) for proper wsrep scripts functionality * add mariadb-10.2.9-galera_cnf.patch that enhances galera.cnf configuration file (add wsrep_on=OFF and set the location of the wsrep library) * rename README-wsrep to README.wsrep so it corresponds with the other README names * move galera_new_cluster, galera_recovery, use_galera_new_cluster.conf, wsrep_* scripts to the galera subpackage - remove the following macros definitions: * %{_tmpfilesdir} - it's been defined in systemd macros since openSUSE 13.2 * %{preferred} - we no longer need to distinguish between preferred and not preferred version (we build mariadb only) * %{with_mandatory_lz4} - mysql specific * %{build_extras}, %{pretty_name}, %{build_readline}, %{builtin_plugins} and {libname} - they are no longer needed - add the following macros * %{run_testsuite} macro that controls the run of the regression testsuite * %{ignore_testsuite_result} macro - when set to 1 it ignores results from the regression testsuite (debug purposes) * %{with_mroonga} macro (enable mroonga build for x86_64 archs only) - rename %{with_jemalloc} to %{with_tokudb} and enable tokudb for x86_64 architectures for openSUSE and SLE15 [fate#323280]. Don't enable it for SLE12 (missing jemalloc dependency) - add the following BuildRequires: * unixODBC-devel to allow ODBC support for Connect engine [bsc#1039034] * krb5-devel to build auth_gssapi.so plugin * libarchive-devel * use libboost_headers-devel instead of boost-devel for TW. Boost package has been split up and will migrate to using multibuild. This results in packages that unnecessarily build require boost-devel to cause major bottlenecks [bsc#1062583] - do not use "BuildRequires: lzo-devel" for i586 and arm because it makes build fail - add the following Requires: * hostname - as mariadb_install_db depends on this tool [bsc#1060110] * libaio-devel for libmysqld-devel because libmysqld depends on libaio - tweak build options: * remove "DWITH_ASAN=OFF" - this option was added because of mysql and it's no longer needed * switch from "-DWITH_JEMALLOC=auto" to "-DWITH_JEMALLOC=system" * use "DCMAKE_SKIP_INSTALL_RPATH" - this allows to link with -rpath during build and fixes quite a few test suite failures. When installing the file -rpath is still disabled, so this should not have any effect on the installed binaries * add "-DWITH_LIBARCHIVE=ON" and "-DWITH_MARIABACKUP=ON" * remove -DWITH_BOOST=../boost/ as we use system boost now - enable OQGRAPH to build (openSUSE only, SLE is missing Judy requirement) - disable Cassandra storage engine build as it's no longer actively being developed (See MDEV-4695) [bsc#1055165] * Remove "BuildRequires: libthrift-devel" and %{with_cassandra} macros that are no longer needed now - disable make test (Connector/C unit tests) as it requires a running server. These tests are part of mysql-test-run now (MDEV-12470) - add suse_skipped_tests.list - the list of the tests that we want to skip (they fail correctly or the fix is in progress) * adjust mysql-test-run options to skip tests listed there [bsc#1041891] - remove mytop utility that is packaged separately - remove *.jar files from mysql-test - remove python scripts remains from tokudb upstream - remove generating of the MySQL NDB Cluster filelists - remove removing of manpages for MySQL Carrier Grade Edition - provide a symlink for the my_safe_process executable that was moved from its location to bindir - update filename in /var/adm/update-messages to match documentation and build-compare pattern - README is now README.md - fix "file listed twice" build error- Also Require: libopenssl-1_0_0-devel from the libmysqlclient-devel package- Drop INFO_BIN from package because it is not needed and differs for every build (boo#1047218)- Explicitly require libopenssl-1_0_0-devel, to successfully build once we switch openssl to 1.1 (bsc#1042632)- update to MariaDB 10.1.25 GA * notable changes * MariaDB can no longer be compiled with OpenSSL version 0.9.8 and below. The last 0.9.8 release was in December 2015, it is out of support and is no longer getting security fixes. * MariaDB Backup is now beta * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10125-release-notes * https://mariadb.com/kb/en/mariadb/mariadb-10125-changelog * refresh mariadb-10.1.12-fortify-and-O.patch * remove mariadb-10.1.22-xtradb_null_checks.patch (MDEV-12358), a fix was merged upstream * update file lists for new man-pages and tools - switch from 'Restart=on-failure' to 'Restart=on-abort' in mysql.service in order to follow the upstream- Add mariadb-10.1.22-xtradb_null_checks.patch (boo#1041525) (See also https://jira.mariadb.org/browse/MDEV-12358) - switch from '/var/run' to '/run' as /var/run is just a symlink to /run - fix permissions for /var/run/mysql that were wrongly set to 700 instead of 755 due to added umask. This prevented non-root from connecting to the database [bsc#1038740] - change permissions of the configuration dir/files to 755/644. Please note that storing the password in the /etc/my.cnf file is not safe. Use for example an option file that is accessible only by yourself [bsc#889126] - set the default umask to 077 in mysql-systemd-helper [bsc#1020976]- increase required physical memory in _constraints from 5 GB to 7 GB in order to try to fix i586 build that fails because of "Out of memory" error- update to MariaDB 10.1.22 GA * notable changes * XtraDB updated to 5.6.35-80.0 * TokuDB updated to 5.6.35-80.0 * PCRE updated to 8.40 * MDEV-12160: ed25519 authentication plugin * MDEV-11842: Fix a 10.1.21 regression with failed INSERT, BEFORE INSERT triggers, and columns with no default value * MDEV-12075: Fix a 10.1.21 regression in the InnoDB data file extension code * MDEV-11027: better InnoDB crash recovery progress reporting * MDEV-11520: improvements to how InnoDB data files are extended * Improvements to InnoDB startup/shutdown to make it more robust * MDEV-11233: fix for FULLTEXT index crash * MDEV-9734: systemd compatible bintar files now available * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10122-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10122-changelog/ * fixes the following CVEs: * CVE-2017-3313 [bsc#1020890], CVE-2017-3302 [bsc#1022428] - refresh mysql-community-server-5.1.46-logrotate.patch - refresh mariadb-10.1.16-systemd-cmake.patch - remove mariadb-10.1.20-incorrect_list_handling.patch that is no longer needed [bsc#1022428] [CVE-2017-3302]- update to MariaDB 10.1.21 * notable changes: * Innodb updated to 5.6.35 * Performance Schema updated to 5.6.35 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10121-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10121-changelog/ * fixes the following CVEs: CVE-2017-3318 [bsc#1020896], CVE-2017-3317 [bsc#1020894], CVE-2017-3312 [bsc#1020873], CVE-2017-3291 [bsc#1020884], CVE-2017-3265 [bsc#1020885], CVE-2017-3258 [bsc#1020875], CVE-2017-3257 [bsc#1020878], CVE-2017-3244 [bsc#1020877], CVE-2017-3243 [bsc#1020891], CVE-2017-3238 [bsc#1020882], CVE-2016-6664 [bsc#1008253] - add mariadb.te file to the filelist - add mysqld_safe_helper to the filelist - refresh mariadb-10.1.4-group.patch - add mariadb-10.1.20-incorrect_list_handling.patch to fix incorrect linked list handling in mysql_prune_stmt_list() function that can cause use-after-free error [bsc#1022428]- Replace systemd and systemd-devel BuildRequires with pkgconfig(libsystemd), which matches what the build system is actually looking for.- update to MariaDB 10.1.20 * notable changes: * XtraDB updated to 5.6.34-79.1 * TokuDB updated to 5.6.34-79.1 * HeidiSQL updated to 9.4 * The limit for the table_open_cache system variable has been increased to 1024K * Galera wsrep library updated to 25.3.19 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10120-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10120-changelog/- update to MariaDB 10.1.19 * notable changes: * XtraDB updated to 5.6.33-79.0 * TokuDB updated to 5.6.33-79.0 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10119-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10119-changelog/ * fixes for the following security vulnerabilities: CVE-2016-7440 [bsc#1005581] CVE-2016-5584 [bsc#1005558] - add mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to fix mysql_install_db.sh script to find data files in mariadb directories when a user uses "--basedir" option [bsc#1006539] - switch to xz compression instead of bz2 for the following tarballs: * mysql-patches.tar.bz2 renamed to mysql-patches.tar.xz * configuration-tweaks.tar.bz2 renamed to configuration-tweaks.tar.xz replace occurrences of "bzip2" with "xz" in README.debug- update to 10.1.18 * Release notes: https://mariadb.com/kb/en/mariadb/mariadb-10118-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10117-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10116-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10115-release-notes/ * Changelog: https://mariadb.com/kb/en/mariadb/mariadb-10118-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10117-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10116-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10115-changelog/ * fixed CVE's: CVE-2016-8283, CVE-2016-6663, CVE-2016-5629, CVE-2016-5626, CVE-2016-5624, CVE-2016-5616, CVE-2016-3492, CVE-2016-6662, CVE-2016-5440, CVE-2016-3615, CVE-2016-3521, CVE-2016-3477 * fix: [bsc#1005582], [bsc#1001367], [bsc#1005569], [bsc#1005566], [bsc#1005564], [bsc#1005562], [bsc#1005555], [bnc#998309], [bsc#989926], [bsc#989922], [bsc#989919], [bsc#989913] * refresh mariadb-10.1.4-group.patch * refresh mariadb-10.1.12-fortify-and-O.patch - requires devel packages for aio and lzo2 - remove mariadb-10.0.21-mysql-test_main_bootstrap.patch that is no longer needed [bnc#984858] - append "--ignore-db-dir=lost+found" to the mysqld options in "mysql-systemd-helper" script if "lost+found" directory is found in $datadir [bnc#986251] - remove syslog.target from *.service files [bsc#983938] - add BuildRequires: systemd-devel - make some dependecies switchable - add systemd to deps to build on leap and friends - add mariadb-10.1.16-systemd-cmake.patch to allow more (case-insensitive) values for 'WITH_SYSTEMD' variable in systemd.cmake - replace '%{_libexecdir}/systemd/system' with %{_unitdir} macro - remove useless mysql@default.service [bsc#971456] - replace all occurrences of the string "@sysconfdir@" with "/etc" in mysql-community-server-5.1.46-logrotate.patch as it wasn't expanded properly [bsc#990890]- update to 10.1.14 * What is MariadDB 10.1: https://mariadb.com/kb/en/mariadb/what-is-mariadb-101/ * CVEs fixed in 10.1.x branch CVE-2016-2047, CVE-2016-0668, CVE-2016-0651, CVE-2016-0650, CVE-2016-0649, CVE-2016-0646, CVE-2016-0644, CVE-2016-0642, CVE-2016-0641, CVE-2016-0640, CVE-2016-0616, CVE-2016-0610, CVE-2016-0609, CVE-2016-0608, CVE-2016-0606, CVE-2016-0600, CVE-2016-0598, CVE-2016-0597, CVE-2016-0596, CVE-2016-0546, CVE-2016-0505, CVE-2015-7744, CVE-2015-4913, CVE-2015-4895, CVE-2015-4879, CVE-2015-4870, CVE-2015-4866, CVE-2015-4864, CVE-2015-4861, CVE-2015-4858, CVE-2015-4836, CVE-2015-4830, CVE-2015-4826, CVE-2015-4819, CVE-2015-4816, CVE-2015-4815, CVE-2015-4807, CVE-2015-4802, CVE-2015-4792 * adjust mysql-patches.tar.bz2 archive for mariadb-101 * pack new MariaDB 10.1.x files - remove '%define _rundir' as 13.1 is out of support scope - temporarily disable OQGraph It seems to need the boost library with the version not earlier than 1.40 and not later than 1.55 (MDEV-9479) - add "BuildRequires: systemd-devel" for SLE12, openSUSE 13.2 and openSUSE Leap in order to enable systemd features during the build of mariadb-101 for these products. Otherwise we get "Performing Test HAVE_SYSTEMD - Failed" and systemd files aren't installed. - re-enable profiling support - don't remove HandlerSocket plugin [bnc#979524] - add 'log-error' and 'secure-file-priv' configuration options (added via configuration-tweaks.tar.bz2) [bsc#963810] * add '/etc/my.cnf.d/error_log.conf' that specifies 'log-error = /var/log/mysql/mysqld.log'. If no path is set, the error log is written to '/var/lib/mysql/$HOSTNAME.err', which is not picked up by logrotate. * add '/etc/my.cnf.d/secure_file_priv.conf' which specifies that 'LOAD DATA', 'SELECT ... INTO' and 'LOAD FILE()' will only work with files in the directory specified by 'secure-file-priv' option (='/var/lib/mysql-files'). - run 'usermod -g mysql mysql' only if mysql user is not in mysql group. Run 'usermod -s /bin/false/ mysql' only if mysql user doesn't have '/bin/false' shell set. - don't delete the log data when migration fails- fix constraints conditions for 32bit architectures- fix information leak via mysql-systemd-helper script [CVE-2015-5969], [bnc#957174]- update to 10.0.22 * Release notes: https://kb.askmonty.org/en/mariadb-10022-release-notes/ * Changelog: https://kb.askmonty.org/en/mariadb-10022-changelog/ * fixed CVEs: CVE-2015-4802, CVE-2015-4807, CVE-2015-4815, CVE-2015-4826 CVE-2015-4830, CVE-2015-4836, CVE-2015-4858, CVE-2015-4861 CVE-2015-4870, CVE-2015-4913, CVE-2015-4792 * remove the following patches (applied upstream) * mysql-community-server-5.6.12-srv_buf_size.patch * mariadb-10.0.16-header_files_const_warnings.patch - add mariadb-10.0.21-mysql-test_main_bootstrap.patch that fix main.bootstrap test (change default charset to utf8 in test result) [bnc#937787] - add mariadb-10.0.22-fix_build_denabled_profiling_off.patch to fix compilation with '-DENABLED_PROFILING=OFF'- update to MariaDB 10.0.21 * changes: * https://mariadb.com/kb/en/mariadb/mariadb-10021-release-notes * the following patches were processed upstream and are no longer needed: * mariadb-5.5.28-hotcopy.patch * mariadb-5.1.50-strncat-overflow.patch * mysql-community-server-5.1.51-mysql_config.patch * mariadb-5.5.32-upgrade-exit-status.patch * mariadb-5.5.41-mariadb-admincrash.patch - use syntax in mysql-systemd-helper that is accepted by both mariadb and mysql [bnc#937767] - fix spurious macro expansion in comment in specfile - install INFO_BIN and INFO_SRC, noticed in MDEV-6912 - replace readline-devel for readline5-devel (MDEV-6912) [bnc#902396] - use spec-cleaner - Tweak some cmake switches to enable more things * WITH_ASAN=OFF adress sanitization WITH_LIBWRAP=ON tcp wrappers ENABLED_PROFILING=OFF profiling disable (for mysql) ENABLE_DEBUG_SYNC=OFF debug testing sync disable (for mysql) WITH_PIC=ON by default we want pic generated binaries (for mysql) - set cmake options for MariaDB Galera Cluster - remove superfluous '--group' parameter from mysql-systemd-helper - make -devel package installable in the presence of LibreSSL - cleanup after the update-message if it was displayed - add 'exec' to mysql-systemd-helper to shutdown mysql/mariadb cleanly [bnc#943096] - remove redundant entry from %{_tmpfilesdir}/mysql.conf. Using both 'x' and 'X' options is redundant and causes a warning message. Leaving only the 'x' line fixes this problem. [bnc#942908]- Sync to git state, fixes bnc#937754 too- Sync to git state fixing few triv issues- Enable testsuite- Update to 10.0.20: https://mariadb.com/kb/en/mariadb/mariadb-10020-release-notes/ * Fixes bnc#934789 Logjam Attack using 512bit dh groups in ssl - Sync the package to git state, redoing initscripts to be more robust- Update to 10.0.19, sync to git state of repository: https://mariadb.com/kb/en/mariadb/mariadb-10019-release-notes/- fix parent directory has insecure permissions error- disable optional features for mariadb * still possible to use them from mariadb_100 package- Adjust _constraints. 11GB is not enough for ppc64 builds, increase to 13GB- fix build for openSUSE 13.2 ppc bnc#921955- Updated to the version 10.0.17 * Release notes: http://kb.askmonty.org/v/mariadb-10017-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10017-changelog - merged patches to packaging git and regenerated * few fixes mainly to upgrades- README.SuSE is now README.SUSE; fix name in some places.- Fix undefined initial status in systemd script (boo #914370)- Fix include dir in alternative cnf files (bnc #859345)- run spec cleaner on spec - update to 10.0.15 * Release notes: http://kb.askmonty.org/v/mariadb-10015-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10015-changelog - conditionally enable more storage engines - updated packaging to the latest templates- fix bashism in posttrans script/bin/shmysql-clienth01-ch4c 1732696535  !10.6.20-150400.3.36.110.6.20-150400.3.36.110.6.20-150400.3.36.110.6.2010.6.20mysqlaccess.confmariadbmariadb-adminmariadb-checkmariadb-dumpmariadb-importmariadb-showmariadbd-safe-helpermysqlmysqladminmysqlcheckmysqld_safe_helpermysqldumpmysqlimportmysqlshowmysql-user.confmysqlplugindialog_examples.somariadb-admin.1.gzmariadb-check.1.gzmariadb-dump.1.gzmariadb-import.1.gzmariadb-show.1.gzmariadb.1.gzmariadbd-safe-helper.1.gzmysql.1.gzmysqladmin.1.gzmysqlcheck.1.gzmysqld_safe_helper.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlshow.1.gz/etc//usr/bin//usr/lib/sysusers.d//usr/lib64//usr/lib64/mysql//usr/lib64/mysql/plugin//usr/share/man/man1/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:36533/SUSE_SLE-15-SP4_Update/94be0c5014c9e6d299baaebfbd210fea-mariadb.SUSE_SLE-15-SP4_Updatedrpmxz5x86_64-suse-linux ASCII textELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=82c809a03d963013b636e1e8f677c06dba480ec1, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=686257e8d4a840762c0b28473ae87419eb92c322, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=abf846f443459e1bfe18744727b0263bbaf0bd24, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=d83aa3d54e447acdd91902fca52a862159333a55, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=db6e6d036e03bd74548a2350a1ed332df08992b7, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=d76432dd7c7cc0349414b647d7457f4e1e5d33c6, for GNU/Linux 3.2.0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=9cad045d907c785213fd0183f8d8be424d0e2f91, for GNU/Linux 3.2.0, strippeddirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b80570acf1e82e88b776125d89fd47fa53f058af, strippedtroff or preprocessor input, ASCII text, with no line terminators (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)0CVi| RRRRR RRRRRRRR RR RRRRRRR RRR RRRRRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRR RRRRRRRRR RR RRRRR RRRRRPPRR RRw̿ Bl6h"utf-8df5871d72858828bb006547be165de48912999472bf4d11ba4e9b0d1933337a9?7zXZ !t/]"k%hASDui0o%HQں; Qށ9*yIXP3X$Wueb_7nИ!7;(:%\%WDH6'-pv~]ې̅&)D2Y6WRLff\ewdTQ7[a/-eS ~cٍu(-DѥnzCcy#r ݯpkU:?-;o!{bb$-rbdp5k镺wĔ! eݥ!;G8 Rf+=4%#v;1 uLͤp*7ONHWLI8 AK^msXЀ=KTعm>mS5Kg+4MWPѾʡ >D4>ّ S>g$["Ճӗ,VeC=#d"Bvő ,<_v hۋҳ/=oE4S@5@_'T@#h l No:`r" 7`x; 2:yL/\ys"B?)7|7ÐSƢm4:x]T\W6pyKx}C7,h~I}hucBb)WFhg`OI` l bx~[q0V] DmA3hM'EBiՎE>g&w?v#L(YwCbA,_Dgyd:m|oW aCO > F"-2r4(3sgհg_ցख̂fc|#5`PùDR(\O4ў̴]c8L^8Ǔ\gdRW p>c?&cOg$-Vs{t,)c:i[MnNN5dX0vs84m=<%u: )(Optv=p;ժԳniLP? _]kUiC"\(/U%Hyw~{mmhH;!D,Ӹ'A"L?:o0f*6k˦pv0SU3#w䈊q`GÊs4\LfE62~özw&Ӊ n18A0CyHN!(_?sʒT}i-|wƦYL.[&(}ОTUH^嬄d`D3L=dvg9W_buC*T S,*b?Jdx- l..SؙraGX > c @&8wc~$ 4}0&CЍЮXT‹'|ͭ+^]yQ똥B%^xP_#Q~ev )K(iޥ NhjP#j8^fd?ȯ9njPͬZC)Zzn^9)ڋۢ)`1,KO[~=D&IFUcH}H\T /iѽ*  wNU\~DzT's$ɉm}Qt$S=Gҙ %PKu]DcRѴgӯa]([/1{S p)CAEz+Z] ɲ8Y*5V;1( v."r'C%zYkF1 'j&0tfN) bD$ HVi舙#PP)e~5y'HF><#^h̚ǯ2*G,Vn$:ҺbFf.b|n~߱'-6o=÷k+PjJ*61L)IcT=nk] Pt7`uĉ`8 㦫B }wsrr 6',pY ʞ!8>i"i%^ 5뿂@ViiBKciվGP.nb_K' -·p  6WLWȰ"ja򌥼!n40Ӄ9^ Dž,;FwVHi=ڊ g~`B?ADWTL7[7y{4)jPg-5:h X)f1 !q6l0Jҥ@GUU%&_\Pg6Pt[L:ZI/+8=ۚ_3#Gpʤ䘖8A(|>*l#/ N<*7*xPr55L \aSjX@ёMnF#.[bD @ I 幧;qoҚnce3Ҧ{0o_̳t3#}i&h{6=3` 6E|=_`ǫ,ɴʌ bUaKrFvS];W1KbTd`I Q(K (7A-A xWfH]Ku0iR%4#iߙG}vZH*$\>J6 *wQ:Q;'۰2dŊ#84Ta2&%zcX#eWDf6B~ЅuwfoJ>)}D#t|a@ (hч* )|6/y mZHFLA\eVvdXn.'C|&YKD3$'ԯ$R T:eUe%v9jBi*迃Yc }K|T*r#pj8aIWcפ!UXܨ &`?eG보D^lG٠*ǿxkj[2}.XTkX V[I."$oP{ׇ] k[7BSNwͮ*Icg|F iQx< OW绑]\JǑLd=LN,%`dƘ 7ZFF%8τɮ8BS?fY󇎀Z0.43{h4WHá]14:@ l#(J2pXSXL.!-H<3/RO;MIs|A/ɗD3ڜ]PRp$?m C cؗ󄤉̏$Ĉ~?Ma uiPP=vk{̾< /[y>^*Nd82CIKTJ6 oMI (잙qFcI_oPb>1?kfBy /~K+%ߘ`(FղЌc(,Xq}o׏!)ԣ=iY-{ps.ǦI6{ 1zǨ NoEyS%9+2(uWvWHoOoxC w?>-wt`/-P}p? AvߧK3ʤ)(/"TtLP^蕴2>dx1͔J Cˁ2oH 8 khe  d͇S8BVDT!F_}l!u.qQϓv2k$LуODŁ8b[|1Y T2Oq(FjM?8LE dҐF'TҧޘoG,cβO[?@ht$-.n54nDgu~B"p]zS-*&sYF]McRTdvpL:6B:oEOd~p񺹖A.=̔HNũ%%ǸѺ j Qxi,l͐WxkԪ?hȺF [XRo^4RC:xR^A?.4m>u*8%M6T˕q Kyq&0 #r4n )'}+Hh#}zxW=6"0dy;LbEK+l0ɿ31"IEۨNFLѿC*j&&kaO-XFq{5CO\c>&)/;7L4S0Ò V┎ x  ELϡP{|0PR& ;GY"'q W Z*I,# na7Z;zu]V*{,-#l%g0A#puFA16ϻ~ j.=E142 #Lϫ#iI0PZ` I7i/۟ݧOLWN^%d /C2U 2$tj؞49 po=M%Hw ",ooJ4oJ, rB Q'&j<ʰpLnU'=Lۙ7<GKH_"Q438e; `NទbmRF ֡y26a&JBdB  ~t" ;3Tj,<&Ο"kVq5ŇG=9)tt0^ҋnRdW_iKL̑3BV=#Rhjv|X7;U2y=aQF!GIn`xv'b]}o$Xs{+ ט# ~z2kN Z<3-7àڞ圇5cide.M?tbC,ݒԓqťvĽ4 7>ט? ȋl\~Oϙc ?a epuL\,'my |g6 *x(EJFhqy:+ml"˕ >DhqH|pepq.Xk '`13G,dNNb9f)xAv0)AڪFfmV-GnFֳ\o=Z(]&u݀=5L[ k~*?E ,ɋpp)FHJ!}Xp @]t:*m*dXō?j.')h\%g&WזVm>^ ^69UfF945W;q/@٢Vdgm*b2ϓi\3_sRT7Ɠ=ۀ͔`Bbh,rb(;XTe;-*ܤ.MqVi%5nh)MAײ)S,T% +KyO1?{n)el[oȉPyff^du~,`㡄o_*j\sDqVGDnc,,ڛc}$<CTԅ̫3CJ!L!&)^=NgxZVM|}ƘƄPF / Az35 ؏4#}qI6iE`tOpi.} VA֘)~obN$614 ~ dVPamwk4|J(XԘ\"=â CsWOV=˶A jm (}b)HZj.ؤc Wǯ 7S--daFxo!3szFA]8?0G':>ӼVϥ0Տ3u:@mC7 ӟ^h zs{5sV5*!R)W͟%gthc7eὊ.qi Ŝ A&.rݔM6~=*ħG3Y>S9cYC.7$-d[K9[ƛk,1#)b,e--9 Qe,mIZu."q_qC-4:T܎ Iuļ&˫Y->Yw17;E;. fdžqr}e˟#gVu(aHHV.sc!ﮘ[}v$"A"Q%/Ҹ;'0sDebovT{D^yd%v$3Qw1idl 3`W7,#\eh i ̒7@[qK F]U ҭM#b|U(lԡ^k>Q@-KߝW9K \JUύa tzQ`zR '=!ҨIa2$ kzp%o(7H9P[niJņd]閳&樯aJ[jQMFj]nWf\$ݓCa%SONH9[y !) yy wCZ OU\@Y w ԳJ6?1:s7r Pݹh43H+  }DyKFXW3I/á.Rm%[wG+Ӂ?r0;G XOV{M)%uȦ#'?UB'gu#aQ5ijOv|XZ6ICqy\YDH~HRgN.6pbʬEoV4 w MWຄ^.n r֨N$31LBh eɄof; .+Ž* Ǚ.lګ祾>V7b[E{/u*冥S2>rO֝S(l\`8Q ΚjzoVRЉ^p+B(fCA-y׼iGʹ+$&͔|QRţJ|+n5o{ZZ!n*idRx{Ԣxc8VCÌBVbј"[jQQ4E}p:P3sx҄3j@N׈'j@r楰x:`n!5v# %z{;@Rx&IZC k|sT C(`dO,ƀghc*:qovn!Np78жJ@Kpf9gW/kі/?8D ?\Hgvޤz\ $>yR4GC'mA MY{R#}vKկX%k'wm>}\,4-\/&Ro>{ ʂɵ"mEMĪΉ?*W 쀷,N[TLKZL qtQ9wSNn*YU"FW{{wja_3jee10q.\ ÞoG:o'n>A/k> L#wiSǾE\!UzsNj(JS z?2GLJ jT08Rd-RGÜ{|{0U"4T 9\j95yoi /n=Mf`MIjnO;;tcaq=d FE}ӠWk?/HJfVnor@[1AOKr"c!_0C'G"/"C/p%TPgnjqßpO QƀS6J)sg> b  93T_f=p ZtuSK'޾!}#}&1VǨ_.2Oũk QAugJ4Yu`) fgD 4^?>,D &W1e%F.X% T+\zHB1cfYt0XN-u$o֯_Q3 刅+$ Vm_ge30 EA_'HU!$Hl2ޝ͛JHS} KTBW~o9ƌ$ EdgoF.̌3G,JGi:{E7̦u+,|ր_Q-wQV 8>~)I~DƔca޳L%uϹDW mWk4 3-l:#[ZuEX= MW^k \ sw0u? [XE5_OS wflXh[4r( ^g3^h#ϣr“i񠰀fryZU_+s;1`Ecم. L֊P3L66cX.e/zЃŊku,⵩>!&=_G㺋~ԽnZ(.a/؂zב 鏷i xJV_g,`wCytDdy*4pg@d 侷d_[ Gr+s9&?2аѮJ.T[A Z70Zdy3%RL`:dh vc5"'޾%AY}&=h$in;pBTf71C݂x=U}R|3iRd:@`n $( 3Ls".r((8Ӧ uD?O+9m_d.â} n(ҿ^Ŭde\~EnGNE1_I6LgN c⼷7Oڟ*fT<4dVvn|sdǎрW)[LJiņ]d1LDٱ H=ي8C"}4S A/r~ &uY%rC/iZN@[(b&G.qhfG/a(V__QL[?}9 HX=xIbV(4ބt9uOru 5ׄItj(tU^Eѷe,>[\PQ><lE @>Simuq y iךM3 Cb,3Je=?EG>1JwUn4Gtu\+|6A,`G ^ I+ch#K#t> 6W 3A|N,b¾5RH o l2fj}K !5h`R՚HczB'TDfsq5k ڿ!Dj/\Z2 /e``TI[o˯Z~&<)x ]g395"UC<4ky]6#U(I%!FTnb)lk`}p1U^ u?@"s O#6*rqOv_;9ͫnjTn%{d6] 3+[jiLĩNhW5pX=a]t̰K70~W?e,uϲ*Ĵ/Cr369K V<㾎aX8%RZ_ }XNIhVRpteDt}=LpEkw4)iˋ(ؚElPhˬ`HXt,E: A›^UfBZR;J܁ob=4 I]j. BS_`Pi>H f\ JjU VDt|sX=XNwWO+aH}C{Vu@. 4ae.s-m<; &ʋJ7FWCh {i.[OTm ASrb(gk&?FE\L-Bi%>m&1F;ܳtojŖS,xv%MpUح[On/]k{Y68P9g1_AkjTqSLF :qv8ER _UJ\`sbX*fY㛐c3хfTthr*kMݍ{h5ȼ'Dk|zT5\(ԣ<4j|)ؔQ^20',b7Yr19@6Q%:Y , 1?=M X@c튗>Oo|ղlFF /rŎ*rnHen+tGS<硸աIcy[á¿ڴ:f* 0ӵnJV ZýyêutCqj& ,Byf,R^1 Bנ3tE+/E)ʛNVi@=+1IcCP#+TGEN327!}8(Gq@e\Ǡ=$(b&+%^C4j `'guW|֎pf璱q.gLΠb(}x)#@iQʛֳSϦ#҈/.Cyb@sS;ij?6@Q3,†e\ƬR{$_af)oۤ8?{-ZX'-@?[a5N_ /~74EEj_=I g5 H9qE I &;89ӫQ4 0wqkyp_(]9A94V:l@tMVf#ޝ)qN'􄮝Nc? 7x6_L=\JI'hS-;N l ȼpYu'Wl+bBbvnyUtP|K4TdE jkسԠzvi*J(] J@?I]d@As1ܛ Ul=cN6VTKs}&p5%<}ZG\^o;nQ?D9Dn<*.vxАfè+/xQ;r%c^ZcǷ=JN۝M)ђkfpûm|;Ey'''[=e{WY t[VrLIHȾN6qeGVlKmCѡ!] KܟViA^,eڟ/{5JO^.C[5J8r>#A1|6mCR~нPm0RexEJ"f̛Zդǟ96lՓKo;Crmz'&Pu ̀M&DF}~h/qTE3ǐm-_`id D¹j ĺ{Cƚ=`V2(=&)?{:75hVa>2+6{ ]:"0e캙,Z<^6B~Xߋ2.Y ,wr]w$]?ߖ-kVL'ѩI4&+ߧ< k¨^:Dt {ކn(Cwk"bb!DVGv)]Py)<[nHfi*ڣ[J0˟渤=2h\T#@Eкb5;EtAؒTܙWin8%ʂ鸹adբwiap ]rnȄ BR7_q^lkUyfRv``0͓ai6P-cؽuJ'ď(A4]Dp1'P K1A2&݅o;>( uKY1FbxCVexmMn&$PNP^ 3pw1i&8R/\z*k GlFV7G6԰,LQ!|EԍimGFME_}h)u oF[ c< H`*&&4I<^ +U {pQaɁ¹4F59φEO軘mT_(fejՃ["l(}km[;1(hyZUiV_#Ű(POj;xɉ줫,o'U$ ý(b K[fgXw+؊YH]g>V{H(_SKMa)^oA]'3IIB N 6*zB ?sn#d {}ݬ Kiv9@92sbɸAԾ@t b3eiY sZ@M-T` lҲH˧Yw~1[v̎=<6G<=!q /.jU=|6~&}P)üNx0R|aT'YL12 06qj|#]xruyMy N,֥0zؑs&o43x_^6LǠb/kk׉Brnœ#`4y |.2dddrܲQ-~9d+lh݀'RoXR_=&Ui'HjN; '.%=GeGSO2Cc |N!-y`ImEĉ͉ -XҶ=V$ӻ>R)_IzR00q{J{Ko7hB |ѭ@s'c{NM}Ѩt,\r}=uIE<%g$|#tI7=F,@2 U$^Ra5ôNcL~,(I,zݺ*dVy]Jӊ0jА1u_ةiUI3Beү:8Md-Z $B 4&(QҔy8I.fN ,9>7?p(r)VI4JȐ)7xjw6?/jFƘ `0)CnnH3ߎYis;S} = 9)̨[rN!`aR0I37EG.8n}ułB򺪖jnƣN࠶*\%b qQh-jqV;S 5ʥNRB,%)@k8fih~8),"i:vgZ{C({ZrP@+8~7LA5퇘o6 EtjlB iwJ~ulFK460_| }ǐRSlu繠ٴR8(v~ߖ>rUdRɐ%!":H 9Lc1Gx3(Mv&-¶/eryX^hxeZ fYsK`PؗO},1uv> DCs}}Za?2z~1T} e*TbSf #oavi׾%~0I"l &5\M$'V/ tq-U@ngP/Mio?T3U 4Ya7[)AK ʨbN^ PX()k#bɁ!2ZoPG &%@)|mI42lfZojnӟ+u Cgr3oA߲_ݣ{CŏEVZc ۋC ;_*?LNi05rcǽo \-V_7|>[{Lc^:}U>xF Hiԯ; ?O[qU,8k{ ϟ'!cҕb-E8y=!zfӾ lA4I\S/UJ%)|N>7z8qs6r9zkCBEK[D*9% 4ifQ7Hy)C,=m}x/iij&So~Ŵ 3%pR d} ٫zȁ&TӀ/5_5^MwYow?I BVk+v~w}} l&]CVcN5/A,6F+q?9KN?42By}PLz^aaFk^Cwk\ħR#>ۏrHmR={'1B+##pF"vۿՑKsW-ℓ&v@RX\RKě֓Q1@%rH67投[N}&'芈D%qW݄ d qM]dL/}yl%.@8}PqjF{CX7 ,ITH:Q;[ɛғhhĢ  ;0ag.o|Vz^ yg(V,ǰR0 BXĚJhs;z&5x-ЬVθxJנ;wOᓉ)ǭ{xsWl}brqB9Prl ·U>dc<ݘ\X<u*|Y~ߛNpŮw5 mj.Y,.c_~|0pV`9lz#|ɆUKPbDt IEӀ f'vd(9_Tbl4]nY;ŜuӦJrKˏ|hɠX L5A;W8C-|fK4Cc1lkтƪxPfL^U7I? ,U~?Rb#ŀl CR*XDcC)uˡh(-tK=) ,w<@{Ps+ OT0'Sd_p֌IdL 9Gߔr-Bu-?$ B8Ҩ%pGƜىG٣Q/_;UbV:xuOݝf/ɠksazȐ:K'#GN4"d.]Gը/C4|UD™|mYʿ%Ɵ wH"U&frm4 wqe̢fRdʬ?g+/Ʉߘʴ $OI[69}P9sBӜ/`Agٵa4gnwKDk2؀R3R$N"8ڠE:Q{ vGM\v% hf w`ly|Ԡ2OԌ~* /G8VvrwYI~Ez[?J v(6Z.β]6֔%J|~Ѻq#E1| +8xJ d;3"˜)BUjN5>Lgb'=$dQ=6ό͑m r$J cy qL掹rnLH?B3aȇVZRvĸ2 ZQhWTٶ`2MfEKooDgX#ƶЉ NEсnݦ}n7풥j #޻T,GI|<nQŖdg@~2^dȣefM5^pq U 7GQ %9UoeEHPU m&cX~~;8ΜG̹ M#WPFkX1cagS=r1mk yw#!3V4x8(ihnO !o<JZ({ounFixtxp*:}u]`ǝu>%ظs#cAq-*,e('}%zy sV^fr+>N.my~0X_8UiE+ 78P- M@.( K ֍K}qyjt gg6/< iːX `yt!LZ(c71 E36u d z_*\[/rvq\墙y:JhQP-ݗuK "y"'ĥ(V(' JtW-^>KxS(hM/Aph ZtOkf"z;}3\U ~N@(+h8|c'<0!K s&` @z=[]4]nfN԰Hd1vzt"gbqtOVqH Or)D0mdrjLe8 ;=b +T^e6xoF+k[x.0 Gv?zT5 g+%C.Et*I`GXߎBn"Tfg)]!P,Q2v1Dld>b@uƹn7I6",ᵰl*{X GFO#z;0`A_R˚'sbkE n$$kdm\B>GK^nJ?V`ٌ>aiDADZa&94k >7>K3Zr Iݦk-3Q,kKI6xfG-fmnM~i]L- NK.[`g\vgw -zO P@nJ"pE2O8KBU72 sm*s(ekp2vFtoxW#(H8 - Z薬&.uL单 Fm\LuгrDfFh/[˛x>s0yXc N mkq?L/*K|7}#}@8& f7ې#I;.@]on sbDXsTʕSD̦֏L6 }2rȑؕ[)̘&1SkBH[*[mRFjBϋܽ$6y5Ri<7V˱yb= 2Hqaw_+)inLV i!@36R)(O`ؿ V]W8J@IجG`m?GNA5ųLҙ1םA8gF@ӲWD+66KK.O72'm1d fnkv=nfyɭ*dP}Dn-[O\EUnn[cuC9Ԝז?՛LV@i^~DYuKbRX"xK D;?o`kJvcϻ#&_΍l= Uyn<$ "Ɯvd!Th| H+a*bsdWl 'l{ кÉklS&R;dž!BW7K(" -h@@:w$rejQVȠg4.m Mh ߵIBsZvGSi$HzbYɶfgRXT۳reɛ[ZwmqVg=je VxlU4LMo2?jB) !8B)wh|&#*HjWX{O{sd[ y!PÚWOc3MYF,N5Jo[X/ v GeA,~+67&(,Pi2y K8$IFȋ"媫,dl.1yJ0sC~ܶ$H:r.j#$ܞvЦv+W}Z6r>M,//SiϞE4!- ,ч<4VV@S! ʿ8bƗVtx$E`BJZrzF_=T!>2wIv9JgZ&cKh<3oѐpGn+#)8\%و* YjeU> "!xǶ (F7#oc_ǩ%fAPNegP9^Td3R ~ H-,[XD /8ku9!\y(RI1I~$thIߑ5,SyKu}#<>{,*`PeLV2G*3.Neon6i |:s/MHf°~ .@ۨEWQ4} aA :o>R;}:F_%z ſ$GWS=Fif bt,}*n]YG'}/3=OB-DQygkuSfү1 .0`4Me(9NQC-پ4"򃲜eq'le+xb 2F*;\,!fH9 TCh76` :q7NIJ"͓tHM=ԝ*s FEă Q<_.ߕMvXͦJ3jV(or>!BkΖĈK- Z&(Cfx"/_ҡi>I0Ukx}ˣA2/7޶ӏ`u_fC; &hh˪ü7scf5J$rS{_Xx$|Z@!gWn )lV=#&g6PS\2ܪcs,F*YK2] lˑS"k~ϯg 'jt8H!F a+bAg-i}ڃ}8(j'_-5N9Z"<׾PΣ Ȭ0a†\v)O/gBߖvp&]sayŰfR-7dɒY| 70<ZFDM)]B׻ua57C]D ;* SLoվv@e ƍvTd4yZ toO}p~}:LJ.;-QJ'apyY|ͩJzS juгni{Yp !)*j>iTU׿EVӞ8ѶZۢPk3PtbQumA05P6`k15ZJh4eګ]ȏ5<Vj'T[[ #4౼72KOfd QTF@Ԯ푷I&հI. 1oMooǞ%q)^&*{:K0c\+9="T-ўOj03QKDc"Y#T9JqZY࿵cYm`|W2Cw 0#Su894Z,5ӄF\ p 8f 8^.jd=3kֱe4dg]*pwi>V=Ƣbd2†&?CviGܸJ!-Yfv'O7FϑSqg*2V3/F27v-^R=9X!Vlkb~!CFuQ5gN6"=pI*K6be# @cGMՐh2 peւ3NDAz6* f' ڂHOR@ԾVDmZ 0^]rL ѓay؛a y{ {XSh^ LGX'ӼۿRوx-{BNхw$۩/?@g`);t1 Ղ+%@brD )1c47py7s!`2H$ʹeo[YjuNxfsh9L;ʿaYo. 7{'NZUoVdW68,=/(4㘙EBݷWOӾ/~8(lQ+È/뻡{ZP@%![6:*VejPnM-Di9Vϓ]`o9/`IϦ;kǸ9QY 1SP$Gs]X~0q+uG7lfk%̯# )39OyD"S(PMwk,+eTvKiDuAڑꑿ>0yWˈn|bg-X;UoO&pb dSWX;hTx;(t<;.=9UB7" 谾]}Vيi͚>یr[[Gyp? wgWh~:&'Th?o J8qɽwnxYrHCmk@>O 2XP's|!0̄$l\E͍8m+nqQ<oe@צWm@97N٩8:W2hn&0($1gKVT=s1Pɿ!G ȯ;KGd(W|M;'۝ݻ32?A8gIegP1t 3ggmO]%rK<`&NTҽv @!3Lڼa>@evxb Yѧܪ`=cFQҕ;nLBG 3_nfxXjwy$ri'1xܖxA*kݚ嘔o؛Acu kޙAeeo0Bg5d #O} o(P;)D$2O1h·ݪI%p>ӤAIAxMIq`n {jC/YH,/q)bSY奛zTƦ& ,9׬9̯vS`bm6JJ<@{F0?^v4Y5 o^Eἲ'k]%QYr#*@ګWy]% knƱW窜8"ћY d-e)5RH06ģj ٣èmk,8>*}'[':$k;3, ^n]F"+=N G{"> q 6*}BukbٱW-5S]]/ GřGi83A%_nkC~4 ×l0yHp9pLp%ZaM600ZA {>B>`HRext"zӣC̘JA0!'DFj5ׇ#KEWBɿwҋ%#TGW")4܌Jths9tT$./zjrpO9iU۩Dz X:Q>ݹ!헁f¡V,l䓋 ;R,ysh8J&6;*j.)?8Ў5_nD9-io|1j.\V5Z0yh)QM2XHkZVu%R<{~qTG yeE.RvǕBLkqVLd|:;!JށpިVdF q,nx`5Yq #zdOzȌnjcCS_Y1~iS0vͰ8# ˖R#Z i/P׹"qE p7&/O?,"gf#KNDzs͟j, z :9IjCfp^:ظtVWA%q)葯]oB'=ck u0ض-_b1%$".vdQ2nSF#~uO_Rlׇ9F/"AM<ه3"(l,X:ˊ:FEq6A 0𱑖Q:r-.Qz~=.g#A4GDkCsr&g j#sȧ%  b'40?{!? ډLP261)uu5;>Ӽ:.ık*[^'֗%I7vTɫtl,P}$EBz*=˺]SYF*25@>uX$nG&eg|ǝN*jl&zE15:1ί8ziFc?{h;YCl#쇾yMUR#.%qK'AXi %wOw-/[CLu -Ɣ5i=~V7AI`+1^(JBͰ5d?zWg*LK+KNc#?w$MW3iExG+m(,kG@#ʼuQף3#9x>iv.ei9^ ?| MTYT(jh=Sw.y#`] (tśiJ!_|Β V,ȖiG ׂ1Aj9j6Ttu Jצ?Ƴ_U֢(/0i˒{*vG? Z#$A{.<4CD:h#r|bٚTsgd;|?4NPڹ\S˼^jNpɟT.y0TPi ek?p(;`Nα3@v˕<3hEgYlj)$n;rT> J_ OvS`Wp+< Uu+26eޠ #-[?& >u/[H1m>9])]hw8:W :5b$ξLfe1=rt}|{8m.;<=ccGOE}s~}&CNOȊp#HL}je)V-wAzЮg3*ۓ*vQi!Ӂq ըMǹ&UI )a1 )ew#Qy%r"TfEщ 1ltp1{ʗIz`͡؍dzH "6 =!1p`HëxDEԖƺ]z9U``ezϯ{,l*˽DՐ'ʱQph'qh.. #L]> a}5SNMn%`u?󡳬0 :GP HMQ < {AQ<Gr%5_Nzq_BRrLoHI[/I]>|י/4Qtҟ#h %jIÅK6-}ΕI+6u:L,eez sU{W]pLOQme(iLw@U<`Aav=3|g,"bmM[hMN>QzMWҶ $x3VU7$~e2=gi1A8")OR/gO&`D4AЫr  rۍ=W"]O hƖk ޅRחpUvy 륏u/p!)ī6pTsլ}Db1E_C#(kH$ 4OA 筊hiEaHj27܉^K3`i8V|{FՐ0{=YQėsQ2R9Πcz@Id9$9wj pe9vSsgH~\K֒IHPw5&J贂R,q(#DŽbڠ6ͣ.~5 G v6@3!Ԣ~?} @!- ɷ,kԥ=ʎV!6>v<(Qބs3SqWϫ @j/?/-{O[:A*ҵ2mn_ki^zqR!$M‚A>P&`wN^N驑䣢 Te#,pGw rWM] K8A43s,c|{v.R`Meg?[DA!&׆cD}35snCL~[;.75ev 'pU*ޙVDCT;q\?R&¬ٷ*W) } 8C 0_H0:ZGnd;y}_↌%!sUm @̂3JȰ{G8< V-p/=W{)kM|L/AdU^0G,&EK_7NJ~l*q*W\n |BܴG{UqQzgwLO^t??_sʨo=ZaD Thf?V|GLkEaP\XpUP954Uy*~~+b(tWSȂWiMBdr\o *؈aI+,CT4В!HR3G+R]c@Ѥ pA^ԭ퐷[=.$px2j4ܙ/-Y &; &* 7vblZ3bP$>C!r;ȉ`WzʭOG^+W䜳 v`5fYvl }8;R4qsKΚjocr4k MmJCN]% 3yU,E- |\W[*Xc+Qs+cT1h<#N˥߯t ח㗬ϚʒH|o!O!|z^Pknzn=\.oPmD BH}]G!Z'u-p-H6曀Mu̘C׃+ !Ҁ0p$eϝxW-Rٜ5\bAUH: S7Z̙SN'O~f^VNLLjcѽ$lg"69ZLl?dv]:#+FyLuMnIiAU84"SEr> ö#&{Ѵ^{aA(XzVUi8q))([3, Kӱ7଼PMcN\_KV3ry6nbaSȩsJ.$*dWXHC^j h9q9=jxrZ"&Dաf1~4Gcoć-ɧs'h= 8M.kɉ# T>,Z&m7N9˻^՛yrVQ3NeLBF0/ZTXcofQ5m8]K[3Bbð2:CtnVi$EF)e)Vnp5D);5U5pVgL#>0^p- es Բ ;]-'aeA]G#n#l]5{aF[Kb]mK\"-XtROnO…6[}H/>5jp.+ iw^wDۥC.:s\~_{=`KD/}lC9MZ729dLRrxrCA(y2dWcn,cz p V$ؘF2:Ē`U/7#,MawP,Jpֳٯg. zy؋\i.2̿9p;ۉys"6Yq!pE\Rnhif d-=ok9phe`P G%$i לyTpNh;H^3z&./1YI >9@ٵ kӹuHSIM"}Y!mcJkWNw"nja1격0}64T(# +QG5Tb*}UHq 䨑@~dOL3n'ОG~m",n _ODhWG1S(ӧ̶ o]IvuA X"=OpSӯ6 b?I/3򋂣-UVǗ9K 1~^= ΧϣF͒)[>ax"O[ᙀB5cF&D\P?h4gYw'*Ȅp=u=ׅV?+8ca3>Bǜd[XTZ/t[g\a*>pzݯek!w;,0}VA;Z6g>ÒgZ WZy,X>'~[[16%q\v:Dw*%N5#m+lBbILuC]X N$}:cοAI/B\7څٳ)/?HhzS/$ӏaW*,1= )9u!8$xLݒ[*c+U/sUOD_w$2YLW`Ot*ˑi*"?U ugɪwSYRhSK%4“9G~m5%%2U\ZA 1Qqxj~`GAΙs 7Y$pX ;Y$m_O$kfpK|9MZUV۸?)r4CӝY8A\%oX@fQŁKvCW1ހ*[g%m _&Di"ǹ?j· %G(jyWfkd|B/1/e'IJ4W3dZe6K5Y\BȻyb $t[iW'ӨbTslg^ 9HZ~LMA/*jEfÒ+nr=κyÈk" `=3o&7BtEEԀF֋ToIHxD/"|m*qJD^]) pW5jZKa,EҶ{~)QgYWChkycT \e7_0~*ܓ)ϧ#]G<4-}vosj^?n/RSWm8_c[ hxlE["`1<#~ &X8Z7<$.AHQ(^q 3=Hr15_Bp`B&:Uױz7 R8CFML@RX$u?md[nj;vcª3^K>E<XaƞK"fDuYՆHLO9xY4(2jV1.Q }bs .X,Lpb6N8fn3gp>k/X7u"r~s6X".\ du5rMx0$k5!F [Or®@U76(26Hwٳ| :dhBrnBMQa&S,>I m{1&!M~-'> ֤a j*: j]9 5_X7?~)442bIi]J ^MD essbVps3J"]d$Z/h>q:x|>2}ԏ[S$~Gn+o) 0Z'I='<"TBVkn\'OWQw̍.;a`xGiN6=] +*c.:ɦiڶ٫(ۺz$:^^y u%m$x5މU模 ź`rdf" E=xlUJn:)oibaa`/yJj^9 108ښ[5&/4&t1J["GqS4YZU:+eM58*/dmn1_Yu>pC8s雓L"+E*"xuLl*;hˀJrq O:ZqW}}m7 ,$`uF(׃+ׅлrCӴ|ŸMFfҧ3z(f%lsM{5>i}}dn:@VID-.`6[J( ׌9߾Zu|/\P_*ow*XF#L?_Iw&؇cR-~69}bӬkH6^վG Av{K4f˔MWv3Tٺ#Vu0c_~y;Ob7+z%mK? wa'Ch:QhS~T6!u|, z js lUf]#Ke'rwBTAÝH' o{Cl(c-|9 %jm)ᨸzGsI?f'xIm",mhcX\TuR#@^Q . 9&ÕD1|^QNeE%WVltjeZ njj&-Gqb=uotM 3}&@;vMorAAeuoX)-ؐ]Va-mpH0Gh -^Y/+v.8fqgTo䝪$/f7M:N3Ђ1r^/+/Is+]@4|ӷvRR>fbZ mHn2%Tf /;j}oqڧe:w]Nx2;q07je7es>9R o]T g߁bG&; i‹ eMIvIy>O$Scܧ O ,Z8]q@z_zX{;H%0ɸ7^kr~W9pܴi-৕GIɕ'O7[rQ!"~VLAW; #\xs"7Gfx7W1]9\~[K?5?fVru6V}"qO-07|ϋTI&Ac|16iWuBs:aR]Rec[N.bf AEky/"u{[re2|5 0ݧTثϏ@ K\}AvdWNh2B%k!ˉThaPӧpq#cuX*WQZQ5"5+||nJp^3T(CH㯞UY-Э V> d͑: d I3*" j˼MiݒX7 #Ie/lZ PEY;EyeSd*V&lCi6^*_w2``hRom0(CjAyTę?#R2 {'m!^N(4b}`=aLɝ_7I]M6Ū@W{ i\'50H!3& |*iqdo;SS}LMm8 YoZl rA[ 6۳|P[NQ^qI aK;ca?mSC0>%B_}ck4WhN~.uXaSl"]~UX<^:ć>nZ|Yt衷# )V/_¢W$vWM&i#,F,CyA@qB| Nz aKaI?F.;O,EVFMhK^)- 0/? !'v:`~SYqlsF'mJACrR~B\#gi'YR.5 r$$&U{CW?yw7r}ۺ"$d΅o)k/RMb\>O\Z{r8|̗Y4D9#ӭK"+3Rz%"cL VD|FfȲ&^*$Fnk{2^@>f0k8%םē;Rn"'Uaξ` $Cn'L4 ]U ;wQ?Rp, fY:NT{ XpJ˪WOj{br£y< &V'N -#HEQvH,^8.1Pҋ=I#w/ ißMP,-@;aÊ j`a>}gsj\ȗC49N =/믍nOLYzDz᪈*|"s]hɐGۅSfOɽ,P'ŒP.b |ciЈ~H0R8(Y 1wma#eⴘ o<^tj1A8%K9wBf2ӌQ'kۭ*Lݤ:>C7O;5dߔF*)-%n5'4Xv lk-{UjGJׇ"wfy]/ZV&a3r#$Ħo}>?-^qՌIhb2o!7GeFzKÎc(!'qK1m󥥳{yQS:O?YAB催*AO$)H9D%ִco#V5qԻ@ub;aͶ t]k"w<) cH^QDPzv=f3PR Ap֓ ;:{/x0⚛qu3M$*)hʏ+ JYFhL*BH4#z'~ ɇ0Skv'&K-0ZpNf}4l>zv1IѺ#K]nIӆK]?e6!lEcDIu˕lIH.'Ӽ>0'5;ٹC,HWXxn*}·f$M>>d?.v,c戴b !9GHN4n{^OG'* {J _89Yt9mN]ϢR%.m~ЛJ$ګ&Oz чy)?~'0#7!SE(EWbDM0p ԕ!b OO*TAܦRScǮƓ,>|ȒD4PtFqE ofJ{皉 (дJFCS ,ՐhR3j{"4:g!څ\%k+k̍ Q'&$dO7q>Nob ?pB rG}Ǧho;)2/cS\n]ދ|efd%6c<^􀯶BO0Ek+/[>܈:6,1xefS;hb2~$M[D@,SW}"\VA !qYhAQT:qq?JwH=xVJ供/^d\Fo+YZQtd/`4UK:.:.?z􁸆"Rz}HG(8=SU\>b!I"vԺ6O#sN?,`\u,=+ Џ p_s̚N5 ?e@8iA 5pp y΍fUʅ%&=7=8[=FdZ/D2Xv".D ",(EI8؆q#/ա[Bxuˇ{ER(?JϩpvYDdھaCAMyځPD٪:';"zdAxJzJK >0MJc >ǺpwA7BDu$|8!A$*. FwKrU^x܀!.H,D08qBf @rmn&k5]$uŪNfH. ,Yօ FK5Gw'OnckяNaXom Dm:Y=2F낓 )\F%F+ↄF̗FݲhC_SdoV*Ǒ,JKFjȐm>y'V*:ODQ42Bܞlz Φyb hc/R  ׌8^kGa3a #m0o չ؜$jgHhYwyqӕ60M =@]|zspj\|>AeK@/gKIu=l琳æ-<2'^j'2X7Z-K~6TwqLJKi]vo%0e2mI} z5-hXG<67€UI:ȧ`7ܮiAl TSRx %h[fڊ Q#G>"q"8Pn &Wv2^Jk/a"mLirqs;}ҏK~|~4, ~=i6ЊTdWMG+AJWvpsBRc@,VhaJ"OY4 f9$TGH9.,"ݻ ?O~ZgKj-yy$ Kh4Qq>&)q\3(F6;?ܓH \ ?CTuC-ZF,W/z/#ݘ K!!d:bi̴YLr) #:g79kTxN Q΍"{;$.oQ_jƨ70!P+tbaaIyfVIMSPqe4|-,…-P]M8@d/\]o沞x\c *U|;r$l_\$^r:U' ŚdsH?I\YY%L!FD}^#e!rY5Łg֕mFnv-6ޘA$YǠ}@З"8g xψ0uW2ԈE#9bׂ##Ϥ!Ӌ*b؜XN _tʰwnx[4{*d Ƣ5S"ս%}aYMAlתjȯ$K[~ ѼYewI@&yE~m7 Tx|f{IF*aBO ]Dr)ry$/h=3'uzӡoզ<Ԧק"EC}kNjm*"B󠬲dJ'm$O5 TszcxRRf0r(tE2tUv9joÅu[nXN-p9.B偲QJm]1%_soKW\/Kt',JK->f8 [Ѓ~mլқ%Kzt%I~3\׫C C1=hF%OW*-5mHd{|2*VJ:G==Z;n)p=m0w`4R3#ria7X3bL]ڨ̂3BC:RK52zߵ/X!ѕ=Ύ #^ /3H,kQcX٥G]ƪh=OPoqO[QzRs!"Hpf0{r:!==eƔ$)?, i2u!g1ށ;=LϘ+}r𹎽6PmN{.(JB9Vh#k7hxWM,컫i ,L Pk }qVbI&d ÊOT+ڂٳ=nfy\Gw 64F߽̕ئĩv?.@Kwsh fu,y. 8*xbNGH'd5Hߔ=u:E;9(u1H;!9B'Ѝ:1Aa Z.z";Q^=OwE/fn-eapD//.yMJ 8syp_?M@O>wE/鹇n}c2d` OFkn\HAg*[;dP\>岆'Okg*$Y%X~v#LImR%K}f%oJkW0+%_'{4N-ʪلtCեctxzCGGcHRKi#f0 & L:Les;8 ];Nj+4ESt&3ԟ@LXY 4IճANW9Wk2Τs!( [P=W%a1ZW|L@XkUQLH`BEZV7KF=#m}Y|i<^b Jщ! A#cVƙ&O&&c4|GjVh'$HͿk4=ŞI̴F)sMWnp.o+xJco$hRbyQX߇?;P?h3U&LM,~Mgq "zK>AI:Z8ʡ?49_=K~xOybE], kCf@,&lnؠKӛkhjM)IhbLTRg5,!YOa$bi[Ȯm(cM#)JY#P}qv@ ?z@)jq{ p4B]gҙEy5Je5#抮%<[3/)4?zQw$^D57)dMucӗJyYu:6wQ&b:߿?XC{b&km*v9{~SL􅮶IbS3,ȓ$eZ9cIfGjȲ"*'j.Xe/uURZLp@NY{H "aUsž c?0& eB{lE8FVI{Vg- `1;DJAPX.p12TA‡k3Ѵ>?*Ynqw P&r¦Mw:iǿP)m9l=QЍm(#) oCYqEnKO_854³l^sH0x.<׶Kgtz@WҜ_0enr}8?aВ Mq7@,5E][AlWvղZ\q@qBB1nrl/ȩaooM 1'rE(a NG$=D\&jMC#& (0R Lt<#LНˑXx](LVV΋EMKUN'Nmjv+8Yxލ#1)AnKhN8OKAM>ee߻1:ȟvS=(Vs8(kn(Efuw6/Q1 x{tIن+On M;rW*-~Uܵtx8O"nO?:r{O`-E-VUm~^1f\/Ⱥl&֟o I]|G ?թCOg׆?F^-\ j"u5[ml,9,Kj)(Y;Hp:"ݯKs*sL[չOYѠX:vM` U+BTb}rsJt7@Qѹ#> huJ$ Ć'-N@4~"OѕmJ}zI6$V9ɬ4r&Ɇ7G zv P$.dR`pX~(WeocC!aAugWkAfYC?\"72vr@bs2_U{j`qe<3ʺ޾wed3/PsѕQJ]P\uZw ԯ}G9A=ߖ[Qf|W{EJY,ܢ̝ Sձ$D0Ό!+>G':0;7JO-3 S}?\tw/d%WN4+YaIԟ6ZdaBIU8]+Q 8»Y됊Eᇀdv^APGo Z?>~ښ2EiEOF:y#f@:ozLf3Fd/.habKopDf|g[v`jq6:Rб:$gxG&/5SPl94}ժܲ!wQjGHAYWof*'_x+1 E[@!N. vFfQt Z~sgBFeuwi,XM@hŒx2]ՇB\H]@֫q'T*LKB!#o&s[p*F,NžOt9*Opl=(V}^鄑lM;IU++5N-A:DuG,"ȵ:?gk(@TxOrY{Dcvob[NE|OK70iC ET.Ñ.2O m ݌eG- // l24v9{63IJ~Ftւq~8!SBs8-3y֢@U$adݔ1ʙA=ވ6@.4 ĸ_rs4~wYP e< DB>Nz?.dK)=r Ll%"Hϣ,B=zQQk%=CnͯUC;sQM5ʒC)8]4Kχ9{K8 ei+>ZFhY> s7>e) N*/FCeÕx@&cpb"ŋ.3[d}J2 'SWYmG6d3"FFg֜ϖﵔ\ɝme-5km){|OaXt " ?ǃM̏ϠR{볆鷗ֱ"VsnrTXcٚ&Q;8,$KmI_3<]T #05B`'<[!pޏŸڬQ1:;X3[ AreF;U)  M]CIfBz+VsQuAИDZ{B|X]g5q2^emS FZҊ`)Uo='Ӑo5,cE!l45KtԱ(m\ZeG=BոijS8u7G ENfE;e7DsshXŌ2ud޼5]Sr_Ʌ(;s<\3]K ʒus*I>k7MZGoږ a\J`Sϊ:87Qls!SZNN4j;Y!҉k~,w`Vk7\48x=08䚇>zP/,E/ʜKж@DGNCG5#LrK@]|ne2™Mhﬓ8! _j?9q+pK5<'Ah1<2ryƎ1[S=a' ?kCnr7'"fgqđ2,ń?E}V"b1crz獒H/=1s+_A#8}gOFnoA>Y !`g!r~Ġ ^̛pL IPy >Pr5aP%M]"iZr{悇`mCHO }RÅ#T5& =I$÷@h,X\+%VNcXHN{|Op8z!I 0QdDu aAeftUj(ߔs@SS &Cn/]@-Xa\E3%^\X\OZܩ۵\}"]@xiwz\F$^ջh'%~g&i ;Rߘ`ƞ~&PIf =U2TҾ;o.aB4=nol6"ji <7unf*u`VH}jTG`MkՎ=Scτ,Qg¡ɼXM|+4rHεC6ɟqo0zLCOB? ;g>!q^;7@$9ծXEL#⬅`RpZYu3ؔް7ށ 6IW>oJttZ{cTz@7DwU4(z%gFߒ8Y vwI\D҃b#[ 8X1qrNjZܦ1p\7@Q";npԳy1Q[LJ k϶ͧa /$w%8ƙ׈cfmZ)4Tq>-iq؄7jPc ~k ܾ S +1jGJL#OS[Y#sD. 3%'>3-dvNKuvk(݄D@?r5._G˥M{iϠibqqRe:aP Aͅ ћdq+(LeFd'U, pn uW𹛷3#+oag *#o O8^Tߎ-mU#-92EO˚6;hd-{е&Jqk E IrLnxE=ό_{uTŞF9-"ޑy@t-wJްщeK{xcwFjB!Loʀ i)[RmH2dnFB%|{OȷBO2»zu&kGٛќ*ͅ KNM* toGbC8|Wg|Ʉ=Jw@?Bف~E'KZ/=S29K~͖3N'aG(#:ׯb,֨, b?3m|k ?{װJR_DYLcM H4.=Wt4t(ѸC#SLŠIc,j//)d.W;nzLN$,}ݐy'~aUZgUwCIe֠kuUZ >TY#|R5}-zNbY=J@)fO`-}OgH- /sAK x=-5fpߓ&z,9w-<:@n2/WJ91;3 ReE&*q!;9:ֹ1NTs`)5{y /vw~u1o- w&c"| Xq6FM=+yGn-"ѐ PϣQ8D ; B}5YٌIY$RLzQ.THtqAzYyP7LC@zQլb&<Ռ0{ލ\'O%x-ld7c9eNoߝEE\[MqnO.鎻)B0pOG%-*r!{[ HR`:H*%qܩ7R0x}#dĄ'a|LcU5q~Њ/VNǚ+v !0GWt]a%Suu*B,fd7 ip_$/PIjkЖg鬭0:,W"xdL⧪ٸ/}B 1:^<`K ݳl D>& ar !`B q>k()z"O}h3DDAB33Wc_Wd[DM4$QiAeܬE.*0|εcX% g dQ3ɰ9?2Oﺐl#If|,k-)Wy["3C1'>Z'I}~y%.DFW=NZ,egIa;OS7Ͼl32jrSŽ)p>=("fI/PSp?,'wrFҹ3$( 8Dn F p(Kh`LxFLnϨʣ}yIX4-^)"b;R ;OO97 MJS_ClQN7z!2XO 4K#%UPSչB?G=\ 1v}4s3] !tyN+R yh_hmh>89X>}\jMu8q@FETH,[!zl\/,BHd h܈O3FN7oͷc)}žk*,2a6vf``T0ObȮRpOcS6Jc|? ] yY9O G Ar:@P0iz>M,f#Bɉd}?=Lg[G'rQ9. A 2u"o_5N+cfRωԪfcJ)`gŢ!_pF|b-oot90gMVRXQb(c5f]y1]654 6HcDj4&:*._E|uzB:yhx^W@->:u٧Kk薑ugS-#cBuTo)'(u{1OLÙjKGUXWU\wr)yn_u:hU_}'G=L],"gg22ަéUL2_qj.JaC4z<<,lM!yz?;A1^8Yw.z3#?=|ʢ=ੵoˏ˨[)G*C3 Z?Th渝+f- 5G,h`{FVx3Lg\I4V[^=+z%ֈQ/{k_رm8gPpb+6p v$WV*x(|G·hj7O`n~^arQGKk )Q J9Ff)`&J(^&nFBw%jW2BW ɱk\h"{ k;.:cC3nR4R= lnW[oxs2YR.&6:ifm`9DSb5{~~N12cS묒72^e֚NH[;$'_c3he}G$*R֮zja?F%2 ^ ^/+Wg; r'+(°(m*M,Iqm{coR+ C~SyOF"<4tv-%N> V]lCLJ/H O.Zi~m5涟Y)ʱmƪdv(ҏ{uU19iqR^՞ot78}Y]n:eua8ަ%!k>^餜2˼V}'5MQwt<>#ۑ|8.s^ᔂ(ˤJ`Z }/A,4R/^Il͚;7ɲ}H=ٷke[.񾾨a3o+>|M|nt3ouV.M!X;\v^!(l`2Y^EWg Zw'!s+Kl]wvK]. ]ƹf|) {?cGwBw=fDkVI?OHamޭR A L ջGJ8A # e_\?T*%CpFG|-9rEDVǎHD@o_Jy\9K8++28=\O Cqyh`_phdԿ+K}i'hnfR"#OjP,Ap( /Ɋӹ9 Ԅ֡¥( %aMdc!5A]9ޯ+Op>HO%E|MG^B!V`żzƃ0ffpzkJF7-oVG[y7Eo4fZ<6Cv4aGy޳s6fR[m,3\(;vٯ}i4:]aR $G=pTkź mUG!?:NLª*R#1vY#J?;ʀ[?&Ú6 Bn %$4OduW Tu俟1O^*tJΝ~9(IInƢ*q[,X'z׾Bq\;nDFG9Ճ`u||t#[>|lf dܥBs)u^hMt ws)w=h#qZgc=Gj𫮹fv oU8!;A9U 9o|9&ρ2X)"۬jH .^)HF(利6R2/fK/}yv?AMIPUKEXWkrtMMۆ)*,Z䪘ڔ`hӇ1FfԆ-L{wFƍܛߚl2kV B&C^6԰i1- Jdٲđ_?W_EhGN{qP{*Cgۺ|VhTh3Mhb%52$1_cVTXE@AD ?q{q:P˗n9?Fы޶Fz{AAǵT Jq;\7k4tEtH(Djey&\Qo<3>d|L# g%fn^]7$;n1wa|j`*!Fx*`"QF#M C#^W?(ej$C1!.?jAЊYڇx`NbzAB:!5Ճ%rBHx ؍-PtˆM՝fᬸyv)7*zCu:LsBP bùf"|],5N63JfO2uf"y# DG@ks[u MtL2`J?@P+> f-Ve4p7h  0PUQ!zY/%Jd N2U+zqQݔK=ً.ȍzL)5}hC @+8|˫tXr33eD+py0 @aGY0˲ED@WRQ*y". @E[q }}R I u w,aՓS &^N;^t :|BgvFbfo~&k` \ BPT@ {ýxg wT0 `*d I3ݽ{3SlxO$dH4ImIeF*,)fdOF &J%[%("b)h+c ] cŠ|~`MY\XG'?;M. mM)@ĭlgX ۈzeA 3'e2څAA 2t; ))j@fb|' Iˠhux4ހLt1>%9C&# ~-\粕Ox HHRʹwǭ$vtaF/2  q^|(GgGx؞X%Gc3-6><6osuʖl8ӦDRIq6@daoRcX`h\n¯TyBFHlkNA@$ #L lɍV/uclnIf}۷b.T)j\Ճ l4p0k/ţ)4zeټ#f('1ܲg)o 4 xEC.ˇ HRɢ*mՠRޗ!5րv#XދT Z/WJdUm'04m!!& p[ǫ7|"~{iŒ(x a~8KqG'.}Xkܤ82/)(Vh]α͚Œ_! ^R}LAo?G7-QfUV'3wmggՌ@>42،T\V~H 8gD3#:kkQCi{?gu}?e6 !v`;@T"*% ;23HTzb8 w0:N ':H1_!a⇶obG#P|~eɃ*P O%8Y'wt0HCCy_T[mE)[89Ǩ@A "G'%` FV W;©zy>f`Ո:@U6 ffM Bmw,ا ,`|xY.yARf@_sp@ZƐژ{L$]h@DOKp썑hiBMq-}D.~b0>)ْly4!-F0PLT^4CF[386_kLJ^ցP aCŕ=>5 9]~EDfq/'\ P1iT@9d*HzT4Vw.+5O|q3iRfWh=ah&PHH3!W2ۍS{qN BKQ2Cx'M\N~NxYarzssU~ݷ!Q}_~g H3~`ȊHcܰih)F*gdӰz 9OIRUPjs/E]*1],BPVJÒwy: "¢)~WV,~q[_]%X1%> ]fQ壛: MH8ҨXۮJ]|&P1{7]yw?ɕ^k2g]X` ΃.)MwJ_d5ˑ[$L1/>/wLMV{:ъ"egac[\G8()WJ,QDĵE gԭkk6X98範,C7ybxddrrN *_'[Մu~U.&ժб]5c 9i}acV]UyLVH@0$TFBI#}t}skfy̫ͯw5=;+*\TvP"4? 48U~t?VT/@]ZqָT4鉶O*?op5q)4pL+{D3=)0c^Q?Edžǘ?Û6 /qZq|._}x\d@Iށ b"/߂pvzg~=]N 4lLnދO'FN>3jwyr$B]$:|z]maa-jZ;/W0 0Ib8G$?Tohs5l|{ާ]}~c; 'ML(^WΕ q! 7<_FN'cW.; gq]Ogc C^ή7knֽN!ig#(d%DRP yt xWf\ 5BE#":7.*@/9dňSgcD>ζhJVLP$O9;i:<:_{+e;%NfFI `BQy\[#5fOek8irwA % }ֿ1gw:n PF"X4kK4m(IJ |RyN>w(_ 0Ҡ!FT!WȤq_aBGvp} 8a NuX>oܑtJ)PBRUY:k Z=\XFHB5 ԡl5,X]~DeOw P"|]1%6ƴ,[Lo{OWiݮիPmf=lj"KzJ~BB |PC !iW"P7ɂb!L1NΉ"GP%!H"!a"5BY˛m\ֺЁ Nu Ǒ8RjI1A66"RADW,F9E() @i Hu r璟'0lCZӤ9dXtHֵ:@pbtwwƗ@'<1ӺQXiC@ 0'ıQ)oi@QmFdc "ǻiSyM[Xb<0be kjyVF*?$Ө_B7 h[$LE4H mmXjYcl[hōFJWС)J)?iM(dPw<猕.݌xσ4 A$Z"(GxrN]C /#hZ+i,EGDٵō+kFQl4$ZJX vsiD*)5F-\@3-)Hj>S$)ѯ%| Ymh *TAep)J(JR@ll=8gRjLU4DLF )fBjiZ)R̡nv dS'zM1r?=zS?%P &m#ܖ!1fj`s"9^3:zDG, B dnv 0@kpcXQEbk%!Ģ9Y5.b !j"΂Hi8t8ky~ްAY.XfC$t6Y*H;WtT aljl W q,S&X`?7_ƪjUbUB  +/-ԌhBQzl8K9[95[/ݴ0<[~03oLiFN-DL" vYv1 .SoPb( %F04EFDA{wYmO>7grR0mwnXm(bHOSG8kB'yۗP͋ ۮ!ƨ4>Qc@  3 04xHdǮpL'T.tteܙPCԍYEcSؚOX`q\X!0X@R =4?"Gۛ[m*&Ev4QFlSkXh5*EmK4!@BI>ӟ>AmPQQl Cƣ3+X5^>D@\AZC 7BK8|a/n㢫D7<[, 6aHN% 0Mw{=Ke\0?^#:u6]p30cHm B {> l.{j|#+=߲(!zJ"0kSz O];@¦J5PB0gCQ#LK݁̒F fg\K-Ԡ#uZRb<, ;m|?nlm&=]4*#$BZ"HkK|-U[! d|FU}3\:PymYj55{WX55WzK?s9r]No*I$dv 3!uϲMFsmRoYt<\Γ!]fsǘ",B vB24q50C"A:}kˡ&5-@>E|tq~Ngwr"li ARK ,XeEZXj i4؁J )t]uu4kM_.ׅ\y"0"#*)a^JZ15as ]8CC\th,3[Lt^E{ΔQ&uDjMf9Y&Qh ICrƝC@1m0јD$v >;=_oFK'ai #*L S@}r#>7Q+rAޙ~eiܶ[-9~:3UfsH/\`c %w77=حc dm+/GkqOHH# =T/#޷7wMe+ g˜iITcXo5\ڍFj<l{|o~"XA 2_b"d PRh$;N+=_U90>D(r%ǔh]WkjmJ4~ Ν|)BPKgwX g_9O*NHD&CFaf|K3]\A`=V?&6(\ 75 Pit_HW Nwv3E%7?#t>Ykqx9EHD@YE6XTUH ZZT{4{Tg^P;# E hdQ э33穂YR_:0›HƎ @ M :(uMLbTBI m y^m-~ΘJӆ(3D+`50➩n8~V!HECS?2lp$!ޡ"Q)D$Ѓ󞖈d/7v_[<e (8[.JH.jgBh[# ڍpI<6\>`yc637s crK| PxG;A:@òm>7u:DjFm49 C2M;LnV@Pt8?K~忴^9ƹefЃ!oC|k{r@݂|a3 UTrԡ^_~BlFqg$-aҼd4cJIx5SZ][PTp{BYepTTm!ɺw)ZR< XX6 wQ~[UI ]m)kI UMU5RJ x 2{vE .UK:aFHI#6@3gd` ;WfL?GD@ąNA/Ybv p=Ԫ;9Tȇ(<T1jmS^4%A1 E*22)7~~ߢr4BG#fѣi$H"$zr{3Fö_jAm2X#g[}s:K4tQ+I,J_!ӎ~jګ 6o@ׄZ^css&x߃qP07;ˆ:uuBeI>*'kMZ469&v "58@rM ;U*Íy~l2;rՃBI)@BZbL $-{kF93+Vн@,Bk91ɡ@p zc@ rORGqK}z_<.Y4iʤBA I$ؽw7jnR0_@ھ^Ϡq6MG3{RU߳~uC 7 et@\"Mz*%Of3_]҇IC?:_,N5! 0Y& 7=`SnXQʹQ t?-i?gSbipsOއ;3w׳֠0k`U%|چb n)@RuZSTì 7nB$@2~s+{_ջc!MXNnRCk);a˩}"qӸ) k=]Bp5ܒ%"3kW] Px.UwT~lq T!A %zl5;U:6W<۰v9C]۞.˃]uc_H6z},(<{ï4$ɏWy =}#^xn(|]\G(a( # a!QȌ͞Ш7`gTf1F`(Pz._; 5+!Ȧ0$ԓ֡ꑄTwa5|{8\%u&[Ee[o_sǷ~8ꧫ;W٧kkj|XLK{dRw*Gp>bX;[Isʤ/ whWJ!-SP2_K<~WJ5Fc=0DvK~?{LNhs2Gw9eyBz=   =}60b[h;rT1Bx夑B@r Cۗ뀗&l{z)ϿW޼onM _hs*IAt`@i_=raV. v?{mu"*!ACzqiqk_QcGfYZ[u\Zn}U:aHj,jr{Dxo7d[XI 6'] {ap:*fS;^l>HrҶphyMBhڡu T']Q]U oTxйw>cbkSUQ~G.>3|_0 J]7#S ٥Y6{89Ϸgj8>BA'<ɇ| /wA~BFtËjhܮ5ϸ_i^ >خ  KbMPppEH)tn-LXRYR(|%DDej)=/ta*qjZYm$aUA[.IB5\mg]5+Gfd4G侮)߹$N B$.MyV]C҈Teoğ[>W?|s;Su,Z۸juQ0  fvb«Ʌ xO4 }Ϭlm]VR(0O sH,D_CTKɻ3\gbzfJR`^h 6pNjaP^EXkg9..ьVT KA=Z BFE#u=#3U Ψ %̈́J*Ћ$v DۊCy!j1BbfBrYE,l&5m".=¥%֍)zw6 HֱGqKPc@PAU(!ɚtK!CcT\Ecv0,5܍8⩀Av笝J Q P74IHH`o.!ACq+2'I.TT7K%8rbf":0uS%LƆ(j(M$Kr^CP43#ÆL6hB%(M( 5 S2-ԃC$}tH1."QJPa P/XH+v*-a6>#*+r")*4ƆlvHBQߑB%yW3;[XhQUo Ш*IU!5B](\ETD^͍j kدBV^5MA)\] ru2V7ke)[E5]"N]UYUvW(&@@/-WqJQ$ d|-W[",$u7=kn'@w^!u2}L6Y)+flPtB彶C\?qck]#ykQtCY J4c RO cQT&aYXD ;5€5JL!P,cZYmaC+r(v͚LLE]2ǿiA)g7HnҊTU]vE|~?aŠ:dUyĹ?#R,H]O9ʚ !pxٺe1p!}KQ`陙4 0̢D!D6%uwScZM4yNK+GEv!T|.A ?M'ߴz]naɈFʆ JF^ ռ/m5T%$AgSuoހ?B1؟rVsrP2 <|?Zj9"h7wzv43BsXxz$M 4P"Kϒ [QѸ7Ϙ]W_(i 9k) D+id B/pA)٥ǻ/9ht+nClont'[ňk߆0׌3L]ѷex8: |רԡS l(5`)s"ba^{a<f[H%Is `x&@f+|7ӌP7;DD`B*h̬bQE}f8$HL hpB審U/$1011(J+x7]2p0 RAd3|ʇyz]*LMԿ3]+A7Zn&ޗbT@0STS,d̓= Xj[qYcݏfP|G<hP;7)$W3?SUte*9)gZ89*C?`a?)_ej" XUlD%}E iTbڀoꣂa7x?& [_ג XɄ 3&2vPߦȎƸ^M^O$dI $$$xo>N;;S5 p/Cݧ5!SECf\pDx԰HI p]{7d`D$g{Q{DHO , lWn^aOA9@;w*I!6E* Rzމ |`P?RKU@฽%x[~."AtV,B`dBRP0 $B#،X{WL?q{q#MÓyr=_QG "iw@rhiX('U燕6 ^pD\@B |+J5Zj6!<=Nap69dpdM%ݮ++c: "` Q,mJ}^TXTщV)9@͗9Z/IL`܈,(E2^{nKQ W)LxVJ^)pP\"൨ũQ`JC## ͱD!+iixw,2 0%-O$DnjNI[HGW4AP[ L-/#fVR6$>o|#LM$q{E ԜD4)8B@% N*=T& .@!pn8UKf*sN@wô l6@!;-f@׋_s`<&-LBDӣdsUÆ4[}=%%AS@S>X}PKC# ?2!kƣ.P6B@+'4sf/qQ =E-VVb i-X\Q $l`tŀ\]W_N㷾{fP28"tTz,x.nNH5o{IThVtwMV3bwhR^  =)#4FdM~K:puLs|*&Kc 2V d2X0PR4V8"-s0``\|SP9$ke'gՎ'L|9[3^L :D ~6wx+2k]ݞ4lqLy4,DAT$y]F平{Y^OwYHa^p:Mzf…ǒf(qr?䲹Ң1:'}ze=a~"ߞ8jbp Wd=;nɳ. EK=$&fHN[HPpgL1ѶȯbvSjIZi)c>pߦ Ո G`7g`.(fw9R.ʩKtlRqΓyY._?+A3m(R4x<Yf*7rӥm\z*, vAE j:zdaժb*W,-,om+c)Lg&͛I"M).* c))G9[mϪ@找̧CSkCp+0s s8ֆbM* ƻ$'5 NלU,,R6')hbtC Aӫ9%#I4qI vz$Nҫ(7,bDK3]'85o/آ74pt愁w &/܄SAKUD`8Ճ]AL#+s ~3C{T{m3x:u.0o~YizN-҃1WDEl4fPV+c>Rz\;m k˾K`=&.]Kד߇ZE/R0aowd`H!( m+S cvvi^P=>T,_Y-mC$ҡ 3kcȜ>#d_^*KsғnjGMRי]U=޳{+Rk%"AO,VE"`h@2dLy~i`X|""jm"lZϩ8 jXVݍdh4)珙6TqO>e]v~\fs ~hz:p80^ <]`|'|[JK ARqCU>jzZ͉-ާ@N(+$k7n {ޝO5A ){}4>C=N**42=2] >o%˜tʎ: n׹Q֒cd[ UI(ԊҞ6@P#fdHf  oz&Rh{>$d7Oc}s v5Dfa{=q=syͼTLn)/ٛWdäop@x=o+;uE^nRQMy׻{vi$xt/.-G=;]ʘ֗{.y>g}z_lhUo/=ƈ xJRAh;sϙpם7I`A4&CF && #!`S4FIɩ&bh LИ#b DM&244Гe6mM O"50ҞziQjDzhPzL4~=M3PJbB ЃF{J=O S&CTy4=44|j%^#~vol8s&}f\ H:>> n݁tX>IZ⿡I:}<Wd(|G%kQP0+ˮ:sWՉNx(:nD׼^zQcqBDD8rC킦vP匍oTs_I2Vyhj_7Ⱦu- r,u\lgf[9>)R&:RJ)ZC/Oۤ8?/=ΟJǭ TX**33n4Yca(-X^jMxںES mT5Fb%ͨ IiŢ,+,biHkWB-, DIU|GoZ5mh6DbYٕ0ƐPdFmhEIN2PZlD2F$ 6`D2P+QmRF65i-{8 )"*HV;glmf^/E;Oi3EA:M陚 " Ϯ1U?wD`,"5(,ƃdIK@%*;Eփ"AL !H D}GIK;O8Cx  1*][Sk:H=)"z@XO! #x~&Ҍ´ @9 F$$Ofs==wz*r30:' لpWGz5˨{;}>7sۿgC>bi$;+f(1&H+Au%1]eRS+S0J iQ،tѶfcYLF0({]2z|"D0h2 "EZP4@b aT! ibje,fa,W%sjsn[Wl2m))` QA T@"1@H%F %PJΜIf`b2F**@5PD*H$A4b!CDjq0$AxzUJE H#!ԁ)Qmd5lAO)!* HT`A8)T7w2%0%T9i hEUlQPԂ ̥JGlFMW:b\5[D^+FyJݼvZQlm%6Jq3h R D0`;A?O(*T^䈦+:OymcXm^̞b[yCS8Rdf!0Vss[!ȶzhxwhdɶ?JcɶE4 fU J.[az8[|<<ˆ4D c"(yivز|!T6()cg f⳵nk ?DW|WsFM\x|G;YJ~fd3%I)A{.2ro BQ_L~O3s`GwCat ر/]cY4+M*K Gƕ]^/}w8O'9 eYGU頂i,S y`;l&ɶ 6"al0 -&4b5+%ЙFe׭LmڍATTE$=ĴVm]AeE2lh4AbѨխ]fm8H05*{WupȷѾuڵGbJA 3^s_G?gFAP7wNʽ<;Xr >LnVȋ$ b%iZZMz@.H5rxQ`XM.珈00J/6&a70d Agfy<˪1[=p( =Fp~l:A ,1>߯ ,9T7j:-'2gDۃ#38Y ښԑ"JOUJ! 0d*2 /49 0 ( BSFT YhX(R UI #A4R0@Zj ! a a$AIB``mHD$H@ ߋ**ŁRsOg꧄َ͈&<7?ÆK|3!b:n܉HXiسm@D@$iYia5 _/s3l[0t #?r 3N%sVF8*ml6 /٢;`Ͱ[Y lYV3tA/r %>,4]w. `k[9gp-~c~Tvˆ*I])Hz" A3h҃gc'U+:K6:{$5*!T%Cm_= ǖ{7&] r'^bǒ9 qU);QJ- 8Tpru\q汫|@HPH*P Қi@]0yOM@D:@ PR4q0ej^*.\}09  XC R5b%P.d k QYK5m󮔥Nf.x1qa%*vp̗FKKRef`&Is  ] HhIMh R9{DA E35QV6i&ip!(c@":!PbM!Yn H\1 # S 'R.M6N y] ŊCX!8a7T:LᰁI5']bn|j-DEiۖfrmͥRەUR5[H*&2e4ʠ21F$.Dbftm[ܦkUJricͳj◛qK*hhK2[N*UVLE$` 6 rY܃tk B%)#Y4WyڼVfv` x9kX^nvl$wtEu1rͨTd6&sX2*hfeLT .8 RL!BIc 4Ð b)HJ$CI Uxph.;4.Bh1$"XBd"@JȉRr$}[6gA`L˒8F;NaS$Q223c6SlOz5UI5D]H0%( CJDC6klk\m`RM@9mmQW+W VZ(mWV^Stdѯ[b[v5s[鑬IR$mm5)(㑬󫦪**6Ůr66x)s2S#x=o_9Eᜁ460Ot'ȰqWͩ7q*֜9ug; ag1STQB-!Wỷ/ϊ^5(<4ujHuN|oXŧ{P*FKP ᘰC2 bG衲wtLWd¶d!I`FVɸ^e#P&k32b,(dM}7={;udzՁS4mtool=\#si|`X.|%`Pd "Q zGxў$oDo8eU2= MxoFQ{`3PzZLAE؄"#q i2"1)(<͹^؁q= A;Z]Usr9bDF4K'E@F@x /L}m*ǾI{LY0g- 5 3CC(q>Ĥdgh]$62`q4)/՝~< AOB"d^_t2:^}b=Mr~c2ZעucsS"2QoKjrD*4Df;w]M~wzsIR[AZE]wD$HWISxfx̂A8>,='EqP A &T9=P $ l>~FUy@Y3x\v%t0H//Ǔeb #Ěa D hXI%w>7/bM&L|ou)(L>5 v%h** ()4m:߭˙Qj%PQV2͜> uHi9G6?``\k?1d|A9!Fds.$䗡xi R;wLв @ $ !"͙e(I/ϽnDqM_(/f~ԠP4.2,4qHzۇ䍝"A/<]meJCd "o@mJ} QU4P= '==:s'ݔ^c 2` ^F v;u Әfoq($|nh|=0~x0@G+ʮAaTmx |p*bR O70 @]sһ4o( ( 0R u `ܣݝu\ 5<%w,q^u!@ք;2 G0ݡ([~yHCx$&0M8\UC:("vmPB^~B:(Pe'\c8[mo2]z-ɹ (&JZj61e/Jw~״Nvs>jDN۶kJҊ{D$HB,05c J}Pʐ =#6!*d1H"X}z!D^Ta*ųIDzwkL5 y_4tDޠj|WWTjomդӶFws35cck2Ng*эG_ \1{ʹ-#PA~a u>Olܑ4X|!r !|0 Xs$Kb.bOd\֑'g AhVh hy6 j зq>󕈠FՒǫurBLݏPѠ3tku(|wcVsnqM21Mj*QU (Hs 0:|0+ Ls.<;\aٔEznXFFzV+Y`R_WH3n.{ Q ExdlE(:Tdi )D.ܚlBaKg2|z?YdwV(UT@NUNB <&w5˻9KuOfaAA$*Hp6 -N~H(JjeL1TkӅWY[BLEVN\ZKl<.x71.վ~5B;>!ێL;]'\H 1@S\ ) "@_F"c0de1ۃIց̔B,T6S@Qtw7 T2o"Q뻨v btG#\*[p#90R%5h8mI_3o]TҰh ,,nóo[ފ + = k,3}3dfz\VꯠfI/?|`AXи7aE1+'ݜ?èvv:K#CPBF6js8>vzUNpXN"p㛙ǔ&\ +lB6Ta5Ƹܯk3YL5IHg M8բwWpZ֍B)'ч.yUs34t򳠫P ͜@ !(< hH/pJnT|u<{0gh9 !h5!ֆV!!Xg.h.ٟp-;Nxw_.}\?"k!NNw>7Ѫ#&;huݧ7;QGMcIyEWnύ %|!a0GBOC\u9^yl]3wvtc1pß ]h'1SUr*"/kB"CJrzEMkJdauU!*^e'SMӾ)J+3 HWPH: 1AMMA8vj cbMѸHDp1xr8[Tz ^$mQ06aNy a;\80tql@sZ1H zmcTU# P)1WJkQK3f0b8=OSS׃[f%&Xy87*ws0:PA+qoFRI"0a]؊sED+<3۸OaC#>]Voq%wwߧdN :hÎ*q`NãaO7 GҒDk85bF`&X_E)@dHlbO߹ЧA΅7ɴw\AeS [wc 4哸mqRJ'hdxN\ScVa_oJ0%yB;;t!>zb8»B( ) )i0mITה1J.ŌAhh((H"cX M% P})P=HclZ̔U@TTIS66Ma!DmF)%*H$K$ڑe& f Mb՘J QQѶ6" lkZM$fc MMm3*FI66ZdZƴZ&%^_ ڐA 'aNI`vexbAUDgPyBܹY,Tli4hIX)UZM$m %i%1iCf (S9P@&؛zɹZ!EƍDEa5$e`E 0'TrHPN6b9ASXo o 44PillU1ѱ /;^5R4b גm2կ5mFn8qYAmx$2K3Pze!LpNK=qpH(ҁ!@o )5~? ⾳pOu]=ءۂ ((wNStM\/ o<ֶ"?aQD0XWS Bdװ wHQO(QP-*+BHKR9"% *$B du!ɅDMp C02w wpԚG^PQ5""b""#Rfca?!D P8t3Tkj-Qc[UIժ(IĜPRP(Clr|zhdQ^2H́`@l`ܨj`ŚuXP,?? r8_!8xGug/s*rSɨ`$a4ABaJ;/̚WP 8*!1( Tѩ i['c2d3BB>d$taMn8Bn2$hhcX z4bTT;AĸRlg?MiB7j ҪkRյ)J+KjnvܱYN-˵ 6"A~wZf@$Sb6(PlIf'1@09.$H3 to٬uŷԯTdc_pu?1{FҎD޶vҫ b_췭v%"7ftHXݢ#o6LlI+0A[rzW6V0$B$M/@/@UvrW0.v;ӹ~i}cv W^R#besjF~-p5 ax9DP˲^5ʕt2 źY}][֛AX܁1mwdIˑ1 k1 Ct&L#n8qIbDKxrmz@@h$}A,'h  [++l~;_a0BW^^.K j(]~j!"4 E4U(cyw~/d(ttr" Dm ĆU9>j$IE[;szx$vGՂ&UHqLj7a@@Hd̳OHr)eMA&#%/{{lXL%KpBDn6Zpp}qqq6i\rխȎX`nd/@ƒB (oG_QvgSobcs{Ѭ4$l q .M $BE =7ZD1ɜnǧŁ.XGPM>J~g#d)I]գǭ:w)[ItuxKxh~?f&[Ap_{eɂH;}:{Uh<Yh,oDsEˍA/,3cG& ]hix?†c E9EH9 !dLCy @|/K~'ΟpO6G`}1'Rt62|\=Ԧ!t'?AcN<#[V?F#Zˉu|K{7yv|Q¨#a@T"Rs5ZʹZfͮj愰'J.lY58r U\ܭڦb-P $ iPHCRQ] 8r( JAH)+!-H)*SjYJmmbmDuR#8E李b+# |5M+IBe`GYp4m H4%x0:|3V4etsV[}>Z JJi5> ml]tkqmJ ь-PR[mFJgCox\Ͷ˃D*}i7`shٙ'ۀ͔zpS$`"+ªE {ۮwsYrškZf[U~7a8)v*䌯/Rz9ٙa (-VγLZ  Z@*#_9<]W!7S2% lcnPmS]!fFyn9׃ԚD0[@4|}Og[NZfEr IoSrGȇb3v.'Mr $8#HO~`e\\HMj S]O$wjv?:$ $$Ha IIG `:) I[`E<By5O9Oo^=j2HQk`}>W? ̓4D1Q_k{gOI1.| "Fϰ,=I(iʟp ϯr{h>#wfga +խ-j?,2A)>m{RQ%@ѠȄ Ӎq"k&qwU {8 :d22[ 6rH㐽98xfsA4))}h@Aos%#DaeciJbRi%mZ7V0WVb{hŎr1[F0\|pqa:Y~}3NΒi_bIMEFJ=M:M}g=f^Gy I *ڵJ,+zMW*{FL)Cri%i(PY_#Q(duVDTJ#ld*N4ksD"-ՠ@ :C?eãDL^cQh|鐯-*8_4§x<9c-n\}qn,{1/s5EQIHcĀ FU*[[gdA% 4 μAHs{OOs\vmC?&0,ϼG!w>9vcKzlYV(<<@jc $,b̑_{2(Pynope ~yw!HLv4<!Wmݷs? "!BnHiLD"8wl.Ma2Zȿr*Pk9!YĢIj~!ɝ%KS+~?U/yوe>r'".OH/\" p}J:?>_iAK~s h.&tiR6W2 N³W % 9$NPD3|T)*$KuHzSsc}}3zU!9rP>}v>vnB6Mg7J.d|p]IJii &HM$h iIs6 3fqe,^ӯw}HÌIdrYxUՍCy,ުH(^X8[MD}Gqtԙ U@@v eU۳t(r Р)~z?ڑ}+<e7Og< GXX!Ϝ~7x)BNaTKotnP*tP'GQKT48P1wh;P,ať^~8x #0Obv16]F)4R%ⴭ Hm(.. ,R;AܑIDF[~LyKK70K-S,xYx ! j_6TA^!Ͱ1"ߗgۂF6ipdcŻkUo$DCW/)+P/a7P ? SʡμrOuwP?`N`"dN/B *PyLx [fXC^ī@j!ȸ~3HPR+}TiEA7TYEsٕLM"06V$ G P8`|: TUE?&; [J|^ s$;$[˺l4*>!< ȱ\ m8M|@@}2Ն%N<L.|.@P\$Օ*j 5Șr!xKۥy-Q <{/o5ӣe-:ɲQp,3#yΐ $h !clus1 GZ7^0Ą5dXUQ1|%fFW}C\&(Ȱ>M~{r#J@bcjK}9J6GiϠ~R]>:U?w )u`sb%Eޥd1'#CZJH!I-~KL-qti@X@&&P'l~xe~\D g_®m㝭rBRc RB&C4>V5O?}@d^-vcḻl1TlvSKptXM"RR!N7?/61R-G^tk0yx^+hFI r rrC̽(~]aٙt 'aA'\)ШmC0/C1t)<Ɵx~3e/Yg {S~B O7J3OyӦ+yA=#_8)aхx0"@m.', \)5Kcv,yveS@k =Đ=d#/YT=i с$2ڣ0 JarZF)$d 1́Δ<343H%ԙ:6!6q4˔X9ؕ+[`b)-/ofGUh2n9XDWr"3a"^k(28E(B! -5Ʃ'æIWq{ӭo70RUg&x1t!Rd"v021[ /uƒ]|4+Ŀ) ]4$Y?T7IKH7TIG)A}(S?,Ȗy`^C:=;2 mCyAOJ@E 8UQ3]ȵW[ΗZPA= u6` tL1)c#٥bC(RI ?WM Asa÷"vaN _`4{ki(ы|\YgAb'gn}qHb͜ N5sdb[ Qkl ulp0xCu)hw̪  l(/}^ǘ<x50Yzi5X5Jx'j<خهArNvIsdY8RELGH EP&OM4m(Y %YYz4ͿF<,6r/p+>ky|#f[!8t~Uᄶ@8;xF#z!`/?5Mb#b&A /|ܹn1NM % CSafA|Y/da+MsZm{}B 6mY!򿑊h_j,Ƶx'gܰm3 | Oq{_%jWRu(4^'MED'ˏ=oi;vUz8a&Uf#%Сۖ-uT8R>lM: VkOHHk2r˯)wL}Hd5 ooMKB0F? m* B #@"wzcOӐh>QeD5j0@&6E$`d\# fV[%jO,>Ŭ5"홋 iƑt<'zD m6[GF460ko ViVp ؤg;9<0|Y㶺_ڋA6m1`Ia378ͦ1\<ll)dMbcŪvMs鰚6mܩ0ož2xPm5υ('alzTl7z!ۿqv?қB[zWr\Vt[|(Kד/& GY!ҧ\DȤ-X ׀B# T=?5z-N{IIy֓:A\&@hxtk%.LՉ8549Ff) Ӳ?)I<[>Io7LeXթ]dcҏ@>o9ĄI`5/d>V4J[6D4B7}oU[z^vQ@jeFla852MDXBRvjɬduq'o'M=X ] c-5BBNxc;Cސʌ\3ȢE!=o{~토L:dI(Ч8֩]u{S4LɘRjӺHwpn^E? GvW~l~ EQQQnE%>}. ,APL G"10"XE&*5Ȳ,?"1ŀeJت'sV^a-,r^||R,lU34o8^=IMͫi+l3"'& vn^_FՏUuTX)Mn^.$RO(Qlb"*ZF5EM#yw4Y+Nb(rwF` L*,XkܶB7UWUAhYMTjљHә*p' GoZ7Y 4EUHqljX^Ě)tk!X|tH.rC"IVx?fvSMĽB9b]dd`HeI/NȦs*0`ڜ&$ Cյ.=)04Yg(#[pk1`sy1 f ̾W Y]y]ڦ:6HWt˜Z[b3@23A ǽς.IU|u3f!0`5l2 >$_ &QdMej(zBsGk5;)&l42j2TV:C.ζMcG^oQla0Q;QAN$A,Q_g?Qc:)$"gz{+%HTQBD9&6b3 X$ys#֒*D%<{ JRˋ oގ )k.RB^ذl寎)`Ўkx֫7s(*$%BIRd+:tHB!PKDG鏳Q Z{{?Uy x& 0DSOwS;txU|xyU56^0l>%mloj HȻ$˿% 2)%Td#}N"ЙpR&~!CQ54]8딧 !הRZK0s+1y"%֦TeYa贁$pUa0|Y%Aӝi TCBG;ߡSC`}’ŻJ}~ .j~4 1Wk@h2pW4/VsUnIt3J%b ȦOy  ~OH"…:Q*8"1HS59WM-SW{ӧhH%-X(6? ԁバ D@Jk. /+H馀zp0W$+^TXJ͛BU#"i3MI-$*SA@bth  #- 0*y~QW钽9/&JϣչO0+I8x_Gg rOf팏JsGocаp= N^2k6M}5|sCո+LԻ`y/9wvG% 92y>W'7d:o`2'md @` ^G^.B&3\ ~vJRO r&wˮ 3P4O֦(% wurOZ7!X4.CHLk.`mm #sȯa1nˆ u}⍜h\\xxLj7ةVJXQPެ/ Bf1rs{X~Mp|M:կ\)CQhTELlC 얰jElN{+hžs˔Pd|ǁ~?O^r[-Y{c՟k}qKt3Ku|Fn[3Uo*Of(1kXr-϶̱EAc[-\=E^Ic'=M;Šr54JuFѰo_<׉KOhĜOw+%- +%?@er;zo d)Cy\R8+NALn8ʈ~ |.=mOV&c-r;坸3w9"_ӥv3'TbÕ1r?;5i6uR?&F}*z:H:\Ml{w>}rnFbri7ն~=C:K?XwYXnQm $&9GkHƽqŸRKw/wc44OCJ߸=vy?%$}?ݍ7"5tglvf7p NFwc6;+ ]A/U".keiO|kxewl CL*UJ<{]}Sd`^!.s\bs,q*Z}Iq!黅AXfXJAw챷haRto&rofv'gJaX(ВKuHںz~VZE/៭m./b3@J FKe,i4u^O'RD83SS<ջf}Ԟ94bd-UN-[cbXŨL7<_@PҴNݜ# If`ُO;vGu7"?fâ8%·-O+dr,#St<|C]l2xm=Ҽufwi}Y[pf| 6Q14T^VHxLÁѵkM[08`̦azzS(kW̅[dbV_.Gf[r$;K*]ApSf@'ml˫E_+?Y|nr2ì];(ü 3zdzK 1b馔4ݛVY}@?(:s@;sC$#mAF$vG0/?ZUt/xߛpO`~,$Prە?'U %Q='ey )Ð}K L=|3ݑm+‰+q(7U+/&$:E)Y\"{2y ?*S|[ɯmd)`de 󟇄Szi}Ô>J9;Bce}ί>v1l>C]g_=s|"'h+!y?HT% D0M"Cl207_X_Fv,(})R3d-i6虚fd 3AcAS]N4Ӗ }_)f@DRoJ?5y/{9*( yz7sAyyG7Q}7;'eJd.Û7Z~ȩ}9d.cA@@l&Ѽ+\|O{y\=_1zn+p|N$U6+$l߿M,ߧlfTcBbs1[k߾{7l{‡o=E$gdSw Rg_L7#ڶ\/ܽLE-5𣏕TQ_AɴT15Q?c͟0AV~bO1|뀰PQ؊ЀD!DE< [Xhn3՘:_vR5ggQM},azE]R`xLGH'I:J \ }Exqs6 ?&H0sNA@#%'# h Yh",SfG6>]4G?  ^v+)Fd`)sQ9Y xa|#  4U&20LkYfPG)h=EhuHmh -z~?xc 8Q~O5%1C 09'>sSUV!XąU`ud?NJAx=Jd,0rɬ?K 8a^ d%RA.֗]e.'H^E~>jG͇g|nɬE.AJHqPݖ,_;Dq\$W$Ruo{% zC*_owuI} I1BrarI$b;陎th*&]Ew'_H8%Bjda1P%R9\8Q )$0bхjMFэ[W:V^!Ph%x1z}WR\UxC'W{ӯ{472@t`lB#B,KXXۻP/\ YWXlH>FީyG#XC'wc[Rz2=_Gq⹊;6~i$Wuێ`€\Ff]u63]5B"iBpxĀ* єaCwh $e(@Hbj& `|奿uՅPڳBQ@ $nLrrTcj\L)P` `d|OtԆ;=<)OV;IG1(6ۀ!g0s I@Q(t?Qp (45`c:Qea <| Ʊ|#wZJa8@/dn5F 4kJgP@˳DT^>#7몫gjdDhJ {`8B *+yG{o},UcpFxw|FFcEug'j Gec-T:lTFC"t0 Tegem1]ڂlyQP/blCe{Mz~*Sˠo{#&>*/]8 wT XF;jաC(µq(%į (xwxQKo-ڷ;k8U/ WV-?G-́кQ IW^0 V4b%nঔĒ#{ѳt6#,vnjo.g6ɅYeer I%2dUѲd Xb9r,) Q^Ցy-dC%EP0'p@V b ~ec}َE2K ݹtY-ѐ鞝^u^]s!1e5sPȹ\-60֌RDi%N Fk0KExKuo&ff*/FY`o}cǛn*Im,RfDj#G^ v}zq AS)$jJ5Ʋhv l!i#dȪ%dS,E%kiTɨmmV[dk!DemlIQN?snb DLMHJ,Ԗ&YMLL!z5 "g U@$IcDi%I,UIik ,YjbIQ(Q xR)3#5\i2CBQ_K@@2BHFi"v Qތu@#,!g0fнDR~T<;:A/VqEVBl !b`'hCǪ-45q 4Rzm< d;4'gCSqj/djC0ë6٫aRKieeb Ȁ 0O!`жZAMkeU"~m5(Bʈ`Bn$KڊͩKtMQ}uj-(ٟ3mmP|9`aZe"^(33R ڐ")? h·ze)scmww(JDmEPZfԦ0KI$K-P*.Y"~'ILDب,JJ&)TN1 'ncgz&Z$ IB|p 'vܔvb`xA]8‚T)Cecﶣ~5!IZ Qi%A~#KMo[}i}c]N?f3EQTPstNsF׊xôQpDˀN,c{o6.-ڝZux/PJDG Z=ߪ=]`K'đM2pCj eaA 2e.0ƀ7[z*-5Y*PP'Km_ws<~Hr.>ν<ъ8?_?ukPRRj ;Lr>c:B:*zټc<TX.Ъpׅ=$8!:mH;X!"yd9!m\)p]n[-*bG4VQ/W-KCgZ(.3cȰ $gǰ^o+%HS 4A)0z;ՔeG_d?'W5һfNHȀL0 0>glO5~+x4薠(J*"ibB4ZHKFM'뚒+bK$hI a# z=0=lTw:A<9 ~  _M1JrX\'k8՞'?-[*hs: icY4!&LOw;p[c\+HWV'"ЌxUxL1]IJ]XuGȲ]ogcLI , ,ʞ7J(%bƊTlxWv׆{3C%b{Ǣ(GBƼy Sj9kHù u7wG"y|\ʥOf_(<9.#ZJO o6wL'cPUViç`#ѡLo9ZWg}s;ktsW<y_{Z~ڨ%ΐ(B=d.32 !BA^{V3X\U^cGYXc6;>͠w  ;~ޗ=I8^WY؋ǝV2b@.j$el}ݒ-_Aiß^bi R1!s*#I9W$}wk{{:My.1 AwyE>Ck%4OF5? 3l&ƣ4EF5WqbcT{ncEͺY1m)v+:놗v6TleSj1iECMyoZťH2̦]5E&m()L[tQC ~'ȚCr!@|q-xtd\~I{?.ʰdZLPF WDUz?Tv 0,s a;I(ۀvsEdyp,'Q$up<iL!d2$-ͺIVWÛ֍'dd?}@@vF_XH=aawC?>Qӎľ ';?c]F߸/1Ү#AB@ !1ɒE)^?!8962ď]S@K"Hs QIlhH>" } JP 4tHۖ颾ȷchKAL皍W)_YW-^e!IrThP_%C UHWQi@6fhJ(0h|B~'a%~0Dz%PߩF)59&OWRP4;ALpB:6eY޼#->t{픒^Lsi7L,7^I ˧ؐ B$<.hiS6 ,;LHլ1eNEQ3RяG[`8ytjnkeE9()F*P|Ss=3QTEQ`LhW.뉶RYMUE>h?q4v  `r(Sf$BVHZl Ap @`d+03߰ 1 Tx|MQxw_yO15->^4P.|Ѝ|mPHu0!(Ѣ4j^vg6[Dk&4&R MIĈ$n9 o@@gBx< qd)D*m&9xߩ\\!}_.p0Cy, .(/z}qD6&`YJ=<\v$>_c@(콍\}.KǷGawȐ6[⳱5t9jtQyo (bڏᢵ޳NѺ̲=WcYkR!ϪcƼn r'I)FyZ%әN{ 3`WA)Jq3.6ƶ&zN4`^Ľǰ'I~\SF"*dU "f RbCKdZl='%?"4*epT&!YBEˢU^,c b,ԻIi ) .n@AV4}N?S$ƍYI.69! ZjṛB-%UA-@RF!w(JZ@,Vb&UڗJX1&CT?*ȲÅ1p,3 8@R 0bղF+XEV*u4ZR[ bѠ6DLэҥr=?6]:Bë[) bZ,&]w.dz φ[plcs CܱQƩ-* bfo$ $"dU(*MF6 X-[jlmFƠ)j(  ʇbֺxN7uO5U^KO\EQ3+ʽJjtV1Fĕƫ} mk1bT[Q֨IIbsmPB4E--)Jv·W9lV-&m(R-+N(EiMQP1 2 BuPg[$3;4;jm\x@@> Fyi% wv WF&›=L(:b'AQ4uI=¨pT~+آyHj3Fһ/k8ep.%-^gsbT8 IZכƍuFfgjDK>D}9ТH 15I܀#‰cdsX,]=Ez~}$V:pѱҨ[t`43=gx3%GsєL(KG֍! -1DrśQT/БY Lt$m|Pa3ù_2bo,,Rk^nVF"Fpos}Ü0mzR r}OICdtR?IrL\b$D)I?W욫bfΎ(cE =W"N1Sk3?trj6}jJkPWv}Cẙs^l qt"ģs kH,>V`KDrz z[oaC[ƃ_}O5Lst0uX !<6%wVgcyr2zXj8u+9KC<0RлZ T˗/ERRO6Gߨ* n4vD]gLk 43c=qS Dia`¨X8xd ΈiGVk3I&CxUّ0F-=_*Ш=&~ZeٛȄԴw2P-FN]5]`ޯ ]' rVZUd.(.1b60pλ|uXk(X&;Bt(HT`5{SHHfOA!w<y&L~-e%;܉4Rpu$f$MINB ^$:~ukvP"\L=dMQҳŽ&}{*iR1E0;?#oyʋٖJRۺ~Dlr`L0MC'A2)[{Zu<|{NSw] (nK%-܍ƚӱcɳ12qh^:*2jH?Ҍz>ډo"[<"x/[1I$U<|f8E@Ʊt. !jf>T4 s/-Z߉d?o8dDVDc(-鏵E[_+@t'2JTUlhU9V>oKtO^' ȁ|O(j30YHAgC$b!z%6-AIJD-IϻUUJf#!Ɋ ēw<[ܪ}&sE]E_VYmk[5/,/hTw^n4 㝺=DNcPvc>eAnXpՊ^Hjpdԉ[/Hy oAVy9a^]dl3C)Vny]J,0%'CrgcLJvlj|Q/cbSedɕ{%iӱv:4IN֫3lJ8—qʹ.֧}lu_`äYѻ!N}Pa\mOi&f@" >̍\L 1 yh0іv?pC)%|1Ю'_3b/ЕL"Xߍj]2<)}-8,%RJe !J xXKL4"9b4פyCVLŨu|1S|է:/C;3{ŝтFiƹU1Sr.`0s٘uˋbV&C]N6/ع_wo(LXΰ'a ib۫L} mHUז˿;[?%qʂ1})-EAJ؜(ʄq[IQ8̞I6^GyQe/J0ݵ5_Ua%!S!鬵K7EktE*6]mf?MK,z-(E>yݣjMg 'T]=%Tf\84ה= S]31`,eޏD!ηS} LhJY&搊f9j҉ &QKrhye(&BjUp,@!o?/-BWюMFA͍õuQ#RsY׏-[cr9MI~G4 8kq۳rP؛a.q+, Olu_Kj>mu1>_`yתBVsڣxoE:sssZeI1q@#JW9J԰݆Tdә_/=f{ʲɊ5C\=KȽ8*Ea2aV*d 9_of%& ZoYGKZ54I-vSb ("uEHޠF;7kb|Si%Pe-e[=]v qzrtdD(M k)/,wlO`@LT~(*7i-9nԚ2c)a  # x.v> yTHn>%`:dmT!R/7vv2S.krΜ^gn{dSe9şcQ4O7eW߉eD& ATtENaR'HԪ+OX4@niF% fPlL32!< ~G 󪾰0Ȏ/Nxo=.&Y)Al1R-7ST!Uŝ 3!E5EAqL1P콫e:rXyI:=/9J`O5m`tChIB6 uF2db8gWg!9t g/2q =IIo?<=*Oc/ EeN}p(bWxE+AS#<_i)`Zʑt4yS&x&*fP1DIJP٨1ۅZ]NUW>i)DИg!q+4X_B F[ԑV3"W`mTC=XwS9Fc`O:Cku7.f څ+nǜSMΚ( = /h(LD1 "hA\DJnDʄˏ bSx:9Į0[]Z1=% TYdzgͯBGIEwF ۛd]n8 2|?m9-liSIQGT *v|:g@ Z8MgCxEiԇ({An XbF@Ԋ§ܼP uլx E4ߚ~9RU<ǹ|Ǝs0zdn}9R۾}J򄱝4']iTK`NzoZE%^Q@ }o{/wX|(GJLct^4\fR|7_Cd!As!SFwJ_зSR,Eet6{!A !u8 rǎ! |GG#yޭ(0J1gHZBѪ*v*ʼ*(랍 NɬF״>f?D2H.5D^B[ٟB@ {ajW<(Irg1M5Y(:q&Xk`׹â?Mf=d1l C,+)貥V^UOI%-W¡SʙT=(Y`S r |fxӭvvt9;fM>sLLKG9?m"Euiߝ&e{$(0ù\xu%!;ej<%z(zwa()|N3,fݚ&kn8ՍkWsj[+MMq,dƛ )-u*}g+o  7RJړb}M[/M)z2m2oaQu!N>Oe:rk󔅿q3?e,a V:q~A͙3Xt= &d*Ԑs/..C%)ȁ+uqᒲ;lHZ:mōkhຝX+Ylj Q/d䪇#H.yw<fwpBgO e$%,OUo bch_\ʴsa`XuoVCӲDэ3 +PA#Ӝډ/K(YPMn')hCaHh4:@՜bLp-Ov}\m CŽ\-gB31`Rl8KSg76D6rRLj1߆j)L~4$TAp%_M'{"m #'s~$_QwF7Bٿy C.= -HJ*ٛL j<6b/#+v{ߢ79_XgdB]0F{}Jg¶x bcҫ B\kBBʦdOϴ'&卑qQgt{t#,ÈDta8E1Mc:gG]:g׷LLW[s| tm-Aa2.R|Z,IZKx9]Ӈ:%|kP'&m .DF -"Kߥ2lNbJ4jDo blp7(vMvΚ>Xj#6듥eJȴ"xޖg~+˥cFDNʂԅHyس=`LRK :D@3tDP'9}Oye՝w~UvX5]%,qj"/;J7R(wQ  `7Ƹˢ4zVXAXnX$ܯ,=Zq{&ilk<,z$-!S~bZ a)}C ;D>]nb6'+#v[o>*Wo5 GЁ1.}q8"B,bWsuz8FQ,@d"c@ Z+i+:f¿|t}h0okB.x;9 sh@>̘ nК`V[M]v} >ペzl⧯BWyd@C_RrݟI$' PCEw pǭM~ SϓP!t Kf'؆/l]1ї,M~[u-Ҝ*Bz<֍Ur4&="HDx1T>lCwKD7T=5&jf_n? {e4rgVlO}pln7k|k*ĂMJ+$0ljh݉ @.+&n>ޠGl$b+OhqUezRw/ϲXuiY΍|OLud>.ԨUoiy~lυWzSb.S [`h芲Y0jj҆a&Y=>AA>u7NqN.Fj Iy{g} Mx`S*a[]g}j%¬K!Z??'weQ=Pz |+Q\g}a8dS[o{0˷œWd#i8QڼM4Ob$@#gY> [f=YPX*q\QJKKjqs2`cכÌ0{ao,a$Ls\kGԜBTU} ,]Dnpsi)#/{4yзݓ'3]\[: ߗ {pBx9x"pQQ'm9}ɯc`3&2NL*ʢ8<ơm\g @"Ȝq i }TG+=Ũp:1OZp֎Fߊ:xYq@Y嚖KoiZb DI?,$<+[bW_V۝v@Y͉V}Ö9u5*YmJVѕ"s>/RI~87FOV57K<5$:$ ,^Ͽد0bl;7OlzV˪ɇ<rszIe%L@kC>/k 7CG 'u ;wS> ^*ved>LiHKʬ`ٶ mC\[η{7i%#)=R(j(pnioJ8<&6.كsjfS>S-_ocI CS>x) 1\yk"\Ñ9ZB@GI4"xQmXwrMތ\>iBvN{$2}9@SoƱN[uhA݄Khw&(lrBeԀ,Bn%g͸5u˓,4뭂{: ᔳT5--ͻ}z>:(hV4?:l ⬪><^s w+:_GupM;T/&ݫ-B"p ,2( "P7mk(ko͆Sg~=R1O$ר$Ŭ -һʼpip!WWfTbxLCnb#熢!+?ljEOwvɂ $W42Օ6)F [L@%m{"}TfO>.Q˕Rs- .W,x8,gAtp?mJvh:[bprL]==nRAQSO[!ю#$^d~I=2}!<;e^ș^B6\w3#jZG;ʞG"J{ܵLv-K,59(Xy<2FmwWc>5rL. GOh'w <: E+%U qGٳVBS>A Tb~QM#&p ScSӑ =|*fY0|I$+m_[l?&b;6eND9BEڂR$9a00*_Oޒ(hv3ƺn  ~rqEvԜQMYWfI4W A F9;Abޑ6@o'[E{DR<$ tåDUV7p#er_(S#rlEʀgz O")>-yW^X|Lq^,NcˤP4dYRxF;EiJ/~G#4=MBA-Lp+Ll\7b.ks D 6]l7Ae֒*8h%Z-y(?EJ~{; V^ =b1yJfsa?w s@aje4N8O5>?8Ǹo1km(hy#K( )8 --argkxm{+C(XAkKv}D._ԟS̱ʠ,f֜tFA)u\Ҝ- YHGcLTi<{Wq6_,h<;&u"BkkIG*z'YrCaЊ$e!>@:cYZ?[ @ NtL[wK+$ɻ'ǸA'k+9e&?0|c+!.OT;Z-]W'nTT$h{MsTo pYY_s)YNPSt=b9x]#LaSŬYcfoRY#/ f5] /ԁjk&~= N|375@1݀d yH\j ਪƖ)(M?=S<3qXzZf" }Ae} 2k郥C_1u(weU"4!(M dG1MDV5 4G{wgIX ْsgXM qZ }o$"_Ckߠ+!ޕ%v:']6't1]~'E2O$;֡Å5Jqkű }AX,,|د^q-.qX6a{{  ɔv&Ŷ>V 1j {TCJnKO;ѹb)rS/NKqg?C6ӳ'&16@xU]L3Xx~W0r#%f&U'uj\Ѵؐ1lMxxp0ekɅ&/\J&pb|葖B+C">WL^ ~-yygL\yGf4>#Q}P428հb%b`.i#1)iz?M[_2~yXD~N*2e/Deq +ur̫d3s=ϿNI~S|Ԛ i?C8q0.a DnNTr\ 3#qE~#BJ㬶^>>ߠ7>pm`34CtJ3[Kp2QyEGJn qy/ӄVVbÆG;3:%@է֕ N#SD@Aa.ULCͷ/"gyv7'tcAJkٛyDwj+]HqCQa9nù5t]tg0Tp PcFU4k xfA&VjR>+keRڗeßLJm䪭zs]17%[ĩAj;8ɵ]ܾl%eOӂ %q#3 /յS]C/Y<p69]Ʈ@q8$'5LQ #k̑7d#}"կhרo,S"K&ol]@>k٬.>޷} 40{ͳ*lCM\:܆ɘ|IEoUz<{5XN𦇦\ӏ5@ʝJ.#`Ȼ^=ӡW}}hD!BzCzW_5x)ʭ pR5'Bbqz&$(0-X͖3vFMݔsR3q7+WoCvJ'UEC V!s2'B;q!dKu+J»^k::q{s͏RCev6qO +8wjfA@ѯI 4G8fGC9ik5un29aIe1:iYbwb$šR46L,U;a*h7Td)%Xh.(~Z` [̒K ?QH \) gi;R*rv~x* }Msgֆ8]ҳS{ye)p_'䘛3/D[1D1H|G%v&>6$1(x^zao6㟆'VLNhOH_7L_j2AJUJ%; Y\/U. [YL|@e⚳~paT(9Z"TgD'1h2R]-GnPA Xjy0B*-",D_^fouK8i3A9q}2P]/#j>4 PEt*|}\ܕJ XE(CQ}Ofam@FQy9>5lC]Z'B PcDa(NlJ!jr52]JX^d|\rg~ ǚagnYDTz`E]K(J?.uc-'×OS_R D8)ue.[ #iaC#dA{\Zj/ 'ETuV_˲4\f;噜!T:'Otf2,1хc+"ɚ_94L3Zx +%c]|'ŜQ v9 >QQ_ޫ5@uc䒇2WN8>{|>!dWVgSN"$d4Fw>np"y I> , Rsogg[tּwmW1ex"ƣktP԰ϜѮ{=SYHϟ_-fgN c(gn, *W-qwx$!M2TT^dJ{>E9^a`C"ӧ} 9KlJ>G%O,+mj7i:*py)ިѠao x#YZ0o( RMj am!]_Fﶜ ۸8ۉhвrmyک+GX+˿mhj˝ZAm :/>i]_Y@S8mWLcac^-Ծrc}=,y$K}v~jgZ9q3^ =-e6+S` J~!(M-s a|aŸ11UrX.41aP'E)u@C,Gnl%jbxw˘9/Z|Z#r)r[Oxe5^)UzNMG)+ #MdB Ìx07B5@f=5v9PVZ^ԑ,:JB|/'. F45W֋yn R;. L0I-U:lE E,3V̓k-n3\(Q4k :ڸ%пZW0|;$-BzzlKMidݲKZ|!. VY6Wϝ577ΰJ`gkv'~nnqqn55 s:> B3_¾d^8|!7_3IbKZd rRV >kwp8V2G,'ٿ-)#a#mcr-8ruK?"Q<4v4QTP& L%ħoZ%.bXq^|K'KTy1e0fpgWǚ"5ǝ1FMi{a+霼*7s v*,/Yd<|b=?GodDR# Ƽ_[V.ssG)\CdԸަ+asӺ#q$zXR!d$)$y<ւU$L7_Ioy^˩zpDz$W<],Nxɣ (kE/ּA oE=UzɧdM"Z'y5  PH*9P&NŃ*AˎCqeur7,8m{g?/ ,=î,EvX[2 ZϟVhEbWzr*Pk̥5[*NJ ^ro=0^zgNWnF]ϒS;YN ,ضW"& 8]4ۑ';s1O_FJ$JUTӊZbrMyHVXW ńOc?@xdCq[z^x|%WMެ5 Kb2Jo*KRatƷTy߶wv ˒TRډEy'-b֎,5]2lhmLCq\E+eCl4a S67D{14vgΐ.G|Wcr&:aNa4X <ɠD"s<2]ْ8Q# Oc+V𭢷=i#sϝΥ&|ptWRrs9aHAt,p͘~@vV]9z*Ͼ"grJdwW!b/ڠ;pOS4 w_b3]mO,Bph(K wbd I%PVl}ˊ\D/D4qJ\ŴX!(&}&e1Cr0kv}N'E5Bf`R! /XuH$ :t_"\Y'*/ 6).)5wL2W!f5FH y>en5h8fȅ)R7%B<y. __ ȇi{3̕;UȚPl/ڄ(u -Rxo+da-)aYѪ"1 t1$Oc"l=͎ɍ9=z;_[dh@Ϋ> J%eδqs=2)3"M1.3 8w(*hԾBXF }0|-i τ l1r{={r7Ю;X|L3i/VsGt8MР^ }T3ASK1ufm;5(o SN0nx]0]C e-v TőT5mmadkFLrysLDh.0.JzF#Ǝ/+bg. PgʫI@ E'9( ~uPz#="wk ?E,/وgr0- zJ]_(n O6k,9 ܛ.W~-KWO3eu+ү8{Ȣh-kBZ73dj\:E<`+1Bꂲlll,Rr*".$i 8砟<(Qo@ŨU[o^;mB2FXrUE-wUi5^"Y0^#7z(1.(xz ?MZ-̣籵i^hj;nj_Q-RS F0|wG /: 0;x\|'\iIӅ>; ڼM4s>m0[;=yu=?}~d1XՓKmLD;iM쇋D|Ϻ#Ϻ@Zb-0@ )40= >]Q(1< [+3ecT9\뒇+f苴,Xs4+<Uhq?FՑ T3\=Sl*#q `DBqRya& l[JLk\Xr`>đ.=Ps яuD6TO!"6EMszC UC?/>'Pn'}#k (5ԭfo,NT!Y^~G,w0\իSi+Mяm]Am*mVg,ь_H(瓶ր܋dcT\kQ' PӤmw4Iâ]T~;B5 NM4;Хԥ,פP)EΤCe&8=_3mVBƌD^%J͊@ڨ#s_ɥɶ5tRlKȀxع0GeJ;2i`uJB;'B0x_suM@)P?;O(]"‚/X'GCnUxV'U᳔`_}lI(o`x箨R"q2Zȹx社sY&vzfij̋[Q%Q)P}mKsFݔz8 :2YT/yɺgcx꾡,\xbU@po&Iqj0mXR\̽ZRXj$xJ9b nGod\AS p`x{>?WB9% 'v]IV+З|(o?f a(EA'xeE -Ec~ `%8ի0ppGd\;]sz8(p3vLPY01=t+Ė8WKac$Y2 auY->7]5vJdtxưJ`8ㄦMDI ^q\3wA4kwv5\c96$h=j*1 kGAxn GVt3IUQށxT+%O/G]z W9:smCO(K0`]X\.H;!b*$$st/&tnJŇg@_wǽ~Nlk.pʳ@ , giޞ.ٛY-B*)s.*m_ jQu*S5U!QyV 7'Ez…_lK$hrlT;ى\_ o"K; (emJj(fi k^f]^ p(p6jy:W-o'ZEN i/սilvRs^t%ұYg8 ètgС6®>9N}yޔ4x8ΖXSX[&ؐ6y)&*o"|Mzq^\vVKEXr < &Y+X~)`Td6z I;dE:so 14Y/*rCEL"vaZoCR$3'=~8A !o;(ɶ3jA@l DI!82|uX<:wS7v] y+NRː};q\x @TURg>8 6ۉ?qhz$W|[`V>=㴯LQ۸nwFn7ĸ3~-]\ռ30ON[&O"hTDTFN\b8U%>X`~%lTlysykI<7 7Ń)i J]X;u{U6Zs@T-T;+uXrܽCpKfhvw|- !pa.n@O)~q^( cᧃ%NK#KQta\é$͹ٸ Je2'gt!GjJF=W~7LBlbCz^ҳ8Oni QްwkI! 2|$@XAs2u|Zbq~ yD` * Df#7#_/Png>Mps.E3en*|i qu9KUJʵ@Asďy=Go&@tpAN11.x~@$BcLJ#@]5q+6SYeԏY JGJxZkBqhߜƌ1[rjy>g;_X`ccjxFx.}BVX4M?03Vv1tk:Jz^s4 {oQ./ۦHhdȦEOsn#.R:Pz\d[A2 :eDH1`L&ww6z| 92dѽoiD6q 4Bgd#jGMոlOE&yBkFo]Ԑm~XOrnd+&) `eRv{r}=ODIY~(6uQ*'7vy<4r7$U<$xz{ZУ|6 vQ"A hlxHJ|yNs.0A]+S8Y]G'ZnlX Kxx}c,;ARjmM һfчJH;?Gql,ցK vjdIL`RoGNK[vXIfPLo2Ӻ4v66 Ido{GX( \ܿXg>ac=n&>kB8* #Pn':ͳNђCRL _ lp:YE;=36p FD=/]2L`FpܾAE e d/^6RR1d IB8 +0yr@ *وGzsc W<0N1?]œlüAH] E! LongBr77l bgvI4Ktg.G Fe8mm| y۟' w Rg "%V׋F܆ߪ@Ȯ)`k\Wy&lߟ5A\0zK{`x j-i?[ 0~,tw=^k?,Ҟ-kΦ`2 C^*oԤ~ujV4ip(q.79fJp@q_QzBV 6$jCAǓ^Niղ1{7M¢ J/k4>[.VrQ~᫝Ûg1 a%Y:8 Yoo"Ʈ@,9.̅C;y?;Å];z?bɲc);dB3w6= mJV` NKr^V|͔p PѻaXz>i0ysBl~j7q:p9PG{֍L: G1$ ̶!p`[`b k()9p;Q*$m|++p~[5 #T/UBPm@딵 `UuN\[IESеoT\[޹Dn|0"bD٤_]>;5 'be|Y]-iQfebޟg%,w'EfYuj<ۮ70Oí=rh"*qeqZ XŸ  G#N͊4>:dD?)H]#^NRNdtIn5` aB +;u8DP4,buW2vO:| ‗@.*!;LҦ' =$'Q\Ŀ.Obk* OuKp/<zx"9Ioۮ C ^,N% @O?$ 6abh:%,vCS\mVfD_eNđ`V2%d B v2`# |V&gFAFXMii:5]9EtnRWI:ؔ;2W";i>X @ٶ;==h/c8smU[Esb0Uq/TslWG '+*Xk]'۩SHa]E; :f{4ڻbRT]i=ʭmc|,Hw%{ apMr`BHr-@2\im?%]h ߚ` 8l#5D 0l,hFh-|/̷ e(&Wj&LvNiB{lp ( P6Oa^Zh<*jc tYSZcM8nš٧ -U\u102vThFEpf=EC-yuo4 p}S{kg wbrHHM"NH@w V|{lNtW݂,$#tH`b !\kĞ'h־RUǸIlIHeUx $ uK|W2=|E="u09m$r~ %MA g8əXE@`?b~3ފ5Pkn2aF6 od+T_,&hMtr!WGnf0[:"`,M%ЊJ8{hy눅vq7vu*5a.:3vyQZ!quOyPJf!/-t%pHŢ}i! h1#̖ |S^I-ڎCh[ZݻaLr-4 LQ0ALyxPl`!O)އf4)6uq,ij8Uxb\U-xNS V(T'bξz'FYI%'҅#e<)ySO[>޾ġ+v$xܣqaYrwzM'۝LM b.kN } wBTS: hɽc]d+ѦkEIB 0K+yB(TAؿ&XJab! ]8]Ѳ!, ?irpvA;(d2G4`lW*\LoՈُrILvb!7n:@E,t\ѫtrk@5WQ}.ߙ vq djIf [b}yx5< 27Kw{rZyUhO/=g@e{'$(meE&\LH\ӛd -evp1/+{(2p: Z!@#y^/\;k,;0#ud?hXAڝ}܀Ne8. C7`j]V*E5zDpc;E4-0PѪBOmk:Xy-L+heaʅ./Bc^)0Ls@-lOd.̼ʩ9#!y~)~'m}~T/.xDIKzl^H ,ʏy&3[C B9.XCԬ<ڍm_9C%HٟoBtj7C x<_095`톶]hx{WWw-3]krM|&6SY2."8Vx+e?خpws,쌣~,2$lA|03 }ȒwyYNx ^ ]sQ+i4xZy>'~ZPc ?;W(XZnn17U<99i:ݺS]5tn9~.Y2ً1F3ychP՝by:>!avo?#wA@x-al|S҂bɏZz|ϝQ&V as)BŷrFU#=GB Y&Ź!$rnX9Y4ݡOY [mr ໔$0PtIYlx/8F7kxtJvE0!Rj2՜$JMBb7@yuJMVj!3CJ? J0DnW} /,u,ʔCEY N8̚r6tTLMLJt=xyAyɷ.8 2Mƶ߮nsew#Ii^7݃G#c5J27[A@ I&ܪhYՠ|Ld`? T,h^qJJ?!;d3mF 7x|l: `}IO4G3kk5Q*fUaa ٺlyK_Ϸپ_t]FjYu'x{|;A`DXGW9!dWY^=7Mreҗ~b {/) iRg4gv{^&  y3Z^ +2l02ur )u6PKLLzD)o -|nUWd$sk3lgbjg5K!FcƜϻqLk#$kj;ҌK :9/_f Z9<0Ii"c0b8. ʏ 6zZ*sMFqIMNIl(=-DJle`nnD-?V{>@Mweu G]탯uDّ:Kx lր҅ ~m!T^ܒ>Y |{P*d^5  C*8-JQ)JTn)eR6".4"ɮ86O)̂Se(uPuN$&%|f:2YRtꟄQdX3>XK;BMb[z۠3 t>{q ;yu X9n0 OK!MMQ_m{q]WL.fun^u4+c\(&zndqJQ"];j(~Isټ`Y\cg?YTĊ">%wXY)yΖF-mkjrW.~gw2]1 iM@$ 6Ỉd8v#ς: yתanS٧!y}𤛂W"C]Ip] N'8w`a8IYxײ-GSCIk)nj"dtp1'2W)RoqC ٪f$ j^kfr>;2MW% >jB)ǩPv O9$Av"d=@&Vz\g&Z0fUVMNL8âj X JK  1*1-*u}ɐz#_)3\1;U$^d@LY DVɏ"<+b kYŷCkh~9]WW,.3g8 ZmbZcDxA56b䌃'+C $f#_8V4@.:qœx(R]NRvr(?*TΥ; ,J.3w9J@ b.*Fۀ7c uh0l@&[06Q 1+2PoƑ?[Z;LXb[0 |qSi 0QBN SV؟_SbW`M`ǜQ0`t4銻jgG ?BE.ԉSĽ-"=Ñmz;D>.)t7ڝk#RvjyqR|3q7OXsبޤ `f$8Diͩ .EHS(NιqE% @䙚sgI S*m=0? ?h hy(~ \qaw`Svp䳷F]oިT=#pȇ0+ر]CG񼴶qI4  5:|mZUVGuwpɘ800z5N7@akIЕU~Ar0T 8<<{3}kKɚnuT(2¢w氿cڇ?d{7C:ʴO‡A<3Si` ttbBFob*Mπ2j&">tL:ewb̡37ﲱ`5/04wYxkSRh#K@xq0K!O13h͆(ծ=!c~Mfi n^x#}AO)ȴh.!_s v ozrx3 j41QTw'Q%4oNK}^ܕ5BѡaR=ʩp ]"U^2í*Ǭk.nNh+ڇ+p"jaSfS}wahk$S ؇xBqi|EPXdfiU 4eN\(B A`wK` Z2tBVgZEC&Zw!o&/>:IN1ҵDeD(á| ^yj' XRV6MHuܮ[)1dᾱrssa$[9gQOO"pFJG4~T.^8j EWݡUXV-ؔ!mZ:tnuDBlWkOF"{ٽvα#}ڨ J4gH(5tgGYD̿.c2U$#Q'q j ̋ Ў8ڻ.eX{wLBu @~T~q-Չ*xV5瑄U5l]ILadÓq;|GӠt<| SK2VtcKJ,6SYXja:v:6t?ņ)sX! ,R;M'8bLzVU+pgVH^ !۔ӥye^+dcdRմi~][n㝉~;DMKbc7&x_uQ aSbi( ^hI{'qG^aI}!>qB԰T.{Wg)BA8uf 䀍;w#&\mKVWASߟ|q 45Eb{NB\!e>k~'X2H o;#9l@kxq=ЩgaЄV-A/d+P=lQ8̶eb\O{~Q\NmBZ` 3\T>NY :GbQ8#;~M%AO>|C޽  ⫷&^WƎV+0C6G;xdevΞt x:O 8 _'u8̞$ɓ}C8ͩ,fZ+O愊]y5r:".^R;$N^?/ԫCTݘrN:T޿V:..Fa:@mw !A ގYaC_6oX}V _f_U$x׃Kmp kHH>pѰ}Cܑɂt'ͦu$T}3p]9cH]J!Őe•hGwXD 7C$`x]"z+>gܪ SZ^8eT63[Wt^/ӿmPs.S*4dyZ6tESCl!CF߅I,k1BzeEN.sHQD}JZh.ޥi M{eO9 `vQ%~:t!CUJ{s9I#:WR DdUѥX%;LXBWGH}g+Ԃpn+-zd厒gRJSy;fԟʬݶu+  ISɗ0^^Xʹ*Mq(d\,[۪&BO?!YTo JH+.5Z6Z_nxm|"j"O:l[zjZMk\ձlwT7%XwoS!ӟݥ>tvYZ,=3KE>jV!ڦF'gHIG.`"`PZ| m+賋S:Ya{/c=+*Ք|𖝜 uO-+@Wjx?qrES?}J&HwA6pQ p$w.@0%^0l=ײk۝S5~ž؝gGtTf,2 }|"pl5 z)8 KoKe jF i&_`#٢v_NnPd6nk^v^C:ZV҅P_9a/N4)3mv749HP+a]t6>U")kX4i0+azi} UNTP[oŨ|Nʣ(P8q ʉsSNkr0ڵőR 3[va!SY%A~`(; !K4OIU>06ct ل!Lw{l/Ȧ7%i+s(wZ{ǁ>"x__xͶ7 rM{5E ¬2Pc%ԧn\F\W1+|fȇC_m_EEv7[ OgޣOW~TbGe#K,5<l=Ekg7ۺD/ǕW$p_ nigL>r.{DƪH3\U*;IUIxV 8+gxGRp3b L)BR<L JDFB'/aR%a~QWm48H i|UX)_ۄ"o\ڀ7ۛ-5uTVT.jqXe=% %"lj&GuSaťY;h)pzXB:l^[Jј'V¿gXfS#u EMQX-G;fyTga)#``=npS /"0z[(~uZ?SJ-?VRe:8+آ7=eNFA51fEVf;zp𤄇GaߊRlY΁i117@/6 MS1ZnlxoR*$C@fؙDOk`=Z\: ؏ɇbeBkGw6{2|_a&ƛ)\HY,hI:E:y^$(eXl-a?%UvN TEZ^ 4.t:ѸG1Y q=phhmb XՑlD9 ̇C:*"q=gu?+ &v{hEvSV;P0Mzkt;Qb7UwMYv!܁&8"7L3RZ9ae%۴Xٷwةy t$;fϒ3kLw˷E]+W0Zxs)f DjmR)T??/ O+Y٤~pwB#E =C.]ܲtđS)xi @n,~(8j4eKsj)p8.N^/4rӌ!m"Ŷ!B%r8JԾ3(^?E* _khgwg)2vtNlBqxP665b-4/qf{˟x3w-ޤ|ǒH\ Γ Fa r`=J>̭]ǼM|˒ҧFxfgv@fo8{F%1(,SHgRWؓ]fԌca֝@ypB{ds5_(#\jxEvIbxQ]rMj~UD[w +rd.s[DTS=3m[p rk?O~ǃpT17fLK`u>%>ڪ0X q>T$o)2B^{xMVUX}ѥI%7folo)T,CU]-D\vA2@kF|٥f$ |hVPߔQ{H$ sN>ؗa͢9x[g0 ?s3 @ĸ ^'~ HA?-SBI޾(x3ڻ0]#w5_Μ`O%΀#3.ʡ#0bKhcYlaJsi i_PGsTa/*9ϼ+k*NOow'^ e^([Բv|Y-v4y|i$zA _.][it?`M6\y ٞ־ghm?$RMBNj.?&w˝`daΡ|g884YRG9J9\)>ʨTy/JꐏXq~FSrGFLlQRY>4c&dAUoآ*`hB$\<\] d[ÖB׀ÚxgeW3p4gZ+?|nё٧IcnwK {B5vE$a _8/Or{E弙ϣyv r2?lZyl##BT*ELx&A0{%]v,ed뭍Eg5zyE ^snoj3t@|^1q Ŭ$i <#h]bm|i0ۅ[wR)MP6GGA6Ċ?OxSd  Q}flw+LG#l!!{ ! M|4 kƄN{oX,DB[ !BHNv|>.q9qb0+F`vtZ!j)~8]Q\5Sk? i 'KN̕"ˉd>!l{uћfz/dK }Ek7()``t@s DЉ@=Z&S*vҡgaRO}z磆BzmYoJ,l^s̛o>F} JV(fxoIQdW+ ?STKG*OB#1'j rv8?K 5{v\Gh?^ 9#C;< ƛA- Ś`_dhRp[}Ƨ)"F+KВS#W7Znt+&^EŶ`m (Nq˧n~ Уȡz 8.P*зKaP2_$\Y'ʃwjfԴv:-p[zf/.Mo3jߘ8Xp&;+ mTN8w`J'Ao nyS宠|كf8"m 49_87z3ِN ~9|Pĵm+a[x%eHT^aO08'qjZ'\ޔѸadV3xp~`ah̊n^(h['.YO_Y&bȕd:R+f<كr¦ovN,[ ؤ % YZ