NetworkManager-1.22.10-150200.3.18.1<>,\b p9|۔^3[DwX!8V|`gYa}q4'(a9nd7B 'w=(f$ fK(S&z[V>5]dX>u5*mZ,!$ȵ;f:6񳗊X78@x,]enG&(țCSDX 2mi^T)Ľ6^kufnWHBiUg&`"[.3͞P3Hk qy} 1>L?d ' Y 5T v {{ { { { /{ 0{2{4{7^7{9x :R<RCR(D8Ds9FTs:Os=r>r?r@rBrFrGs{Ht{Iv{Xw\ Yw Zw[w\w{]y{^ b4cdfekfnlpu{vpw${x{yz@PTCNetworkManager1.22.10150200.3.18.1Network Link Manager and user applications for itNetworkManager attempts to keep an active network connection available at all times. The point of NetworkManager is to make networking configuration and setup as painless and automatic as possible. If using DHCP, NetworkManager is intended to replace default routes, obtain IP addresses from a DHCP server, and change name servers whenever it sees fit.b ibs-centriq-5|ISUSE Linux Enterprise 15SUSE LLC GPL-2.0-or-laterhttps://www.suse.com/Productivity/Networking/Systemhttp://www.gnome.org/projects/NetworkManager/linuxaarch64 if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : for service in NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ; do sysv_service=${service%.*} if [ ! -e /usr/lib/systemd/system/$service ] && [ ! -e /etc/init.d/$sysv_service ]; then mkdir -p /run/systemd/rpm/needs-preset touch /run/systemd/rpm/needs-preset/$service elif [ -e /etc/init.d/$sysv_service ] && [ ! -e /var/lib/systemd/migrated/$sysv_service ]; then /usr/sbin/systemd-sysv-convert --save $sysv_service || : mkdir -p /run/systemd/rpm/needs-sysv-convert touch /run/systemd/rpm/needs-sysv-convert/$service fi done fi if [ -x /usr/bin/systemctl ]; then test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" ]; then /usr/bin/systemctl daemon-reload || : fi for service in NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ; do sysv_service=${service%.*} if [ -e /run/systemd/rpm/needs-preset/$service ]; then /usr/bin/systemctl preset $service || : rm "/run/systemd/rpm/needs-preset/$service" || : elif [ -e /run/systemd/rpm/needs-sysv-convert/$service ]; then /usr/sbin/systemd-sysv-convert --apply $sysv_service || : rm "/run/systemd/rpm/needs-sysv-convert/$service" || : touch /var/lib/systemd/migrated/$sysv_service || : fi done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ $1 -eq 0 ]; then # Package removal for service in NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ; do sysv_service="${service%.*}" rm "/var/lib/systemd/migrated/$sysv_service" || : done fi if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart NetworkManager.service NetworkManager-dispatcher.service nm-cloud-setup.service ) || : fi fi k&    x X ]!E@ ` 8 x  0< v h ~/VSp ,v D(7go h!o:d8BFl>Q    5u<5 n>RAAAA큤AAA큤A큤AAA큤A큤A큤Abbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb]^j^j^jN9^j^jb b^jbbbbbbbbbbbbbbbbb308ba657a5a151b03dbdac10c0e62979972de20b2ec475b9670c87747d2046aad4ac24338101aef3456e8432415e87bc7fd9e64dd2c65e740ad6305e1caf39f3e035417ff2475f8d16b703d1aae45dad5faafcf1d0ec7bdaad53655e344637e7a853aaa3c9bc902c5069a1f25b28a9f1d0b73a95936f3c362a8332c4ade53b3adced421e3a4e4c46b2c0da560d71b7c4a1ceb80ee4d8bc010d6b669b1540ade3ea648658312deb08c9f450002b60fee28db22fa8791ae151b6ba1af5d15519958bd6b1a49645d0b55c3b53df917165c980b3a5251ef4b2619a002dac7e75167042aeb961d2d54f0074980e33370a9e475735e36852c4d4ff91fa78f0730ba41dec560a3a5aff314cc677c3b5b724eab3947e2b4b9622a9b6dec8d464bad6cfa2d60f33aa4962011f985061da2f0c61c36b74f205d11029d935555116493eb934a8998068f7c5055b02f4cd75422ea63003e7a0e2e1bc83709d31d940b8dd83f7cd7266bbc6aeeae004fa185613a6c8302b26dc4cf137a6b859bf8858c438ca5b666dd6b5893fdf22b5523022b23db7b3919ac3b016645f04fad2fb6a52c1edbdfaae0141f881203b471d1095dc78d0bec8774bdce6a6d1f5d16e3d10ec96d72e7525b2e5298edfa747c595fd2af9b6efd63ee03250b907c8ee1178863bc32a81b839a7889b25beebbfc33be00c8ae5d17c1a7afc00e39ff3bf8319d8e5226c3a0163d08e15af934bdd1153b71234a939e5790c4f3447afad3c75b697a9e1522b22fab51e822fdee6534bf08729b90ce8a28f869fe56eab5f76a6a27299d63602080d2ee92df52508f70c222d5cd73612032f92a37e334b2210d7eadc3832b5d1e070407e588c917bc8284fdda0cb16e94b3a8001dc44566d479afc2ca2b943feec139ea3f47eaad52ea6812816e9dbcc3ddab1c95d0ce005bdbb1664aa862a41e6e5a399855c07e9da7e5661218cebe5fbaa66bd4d6cce90d8cca468d2994fc9410c162d786eff93ac235e78fe06ba92aa1dcf8e43d73b2c52bbf349f71fc566a58b752afb7c1cedd10009cd5f861eda485c0ac05de141614211171ca529b40e44fbc12b1e0d14dd42b5d6a8e85b62827124e036fc5f27962c5e908d567ac12f05386c28cd875fc52eac6b0fc71a6bf84e5b98d8159188a9972677bc48e426e88bd6fe5a5dfdbae3b5b4ce107f0a583120195e2ae6b238b128fca647f77e678fd22fac57c7d6a64c94c3715f069156f83c275d37dde8d213ab53a351ad6e8b00349c7a77f007a68511dd2034ebe3739ad0276e02964fc587f06ddeea38342868cb3ffc18ec6085ca04c816817ae6b6c77ec25c17fdf7c1d2295274d58233ac28a030fd950266b2f9a9b1b0dce35a47912568727d8b7fb107dd5fab10f90e8b81384ca14ae3d3c871c9dca348deb923437beb889df92730ef1344cc37af07f2a91a270a842cfee1f3fe298ac5b58e06fbb17c0cfe8e1d2f4d86db3a3bc08cb5dd0f4e55998c74e2fed169bd76e8617140e8841d0c693a6575e4c89094200b24b7b5c5a084e337d74c8a16b3d69feb381182fda7350d7e12e87940317ba4e08552b7543c609c39e28ada5443aa1ba6826365e8f56fbbaf1b24732c5c590a304628eba831ca7b9d10ce51970a542c7ace39cc2c485b75e680633eb07a5cf4ed1c3d9a2e0f9e177f52a2e1d19cc3d51a6fa5bf6735728692b42f963a495120c5a4451389f2935b793a3fa519e2ef2b5e5dc80025ec5620a9811c2a6fc79fbe8ee55ef2747d5a56c7ef3b06ae49508cec0742748dbe4889db543fafe5d1c5813e9ac760f0b0589d03817a3dd40c260d6929ff5417ddbfcf2a0dfcb503738add99ecb9da4b238170f918a2a6509705ee618ab096c8327362bdb39a322f218c566d92a58924aea6948a6be59f835c2fe2664632d441fc2597f773d2ca9b86f2a3b6b6cff94f762a9116d8348ce5e8da1236119c18bc2d6a77da410d1e44b01628b70c3b0fdb1ea443477861774fdc6ebad3b02c20703539c56b110173225aefd70b2b60dd6bf01786ab0af62b4e26d74ce85a1902f17f19814d4086184f65f8986d53eb7ceb59da16562d1a18770b98538f2e36ee2058ec953543812554fdcb689a93e3d7f7324b2754dc78e723d91ec347161383ef992102f61b16dbcf5019075338eb1c1b83c8f5116626f8764b77dc7e2cf82f0e1431b9cea9b4e53be223638700e338db8eab8713921950c895b933bdd0fb76d1a42f6109e7dfae8f92ef5ace35fb9de910c3e030181f79687441b6f72f8c35ff1c3972fddc6e5469d618242acaaef04c4491ddf3e95ac39190badbe8b570ba48e936445c1f83ec3b785cc8eb788e41010722e31bd7e17273db71940f1daa908efbbbbcbf7f3599311cb1a95b0cbe160269b8cb41a34dbf3ef3ad56b401aaddff61bbd32492d77a0dfd321a15c206eefa8f5e80a41af4d34f8c0720a7042bcda075b350e8021029a9e563acdca4de772716a1ff10afd3b59534f864df8f44bcffe6da92add51858d29deabf39684ba6ece1c2cdb6bec5302e77841bd878960d839cfde78b0680d176f7642134c7760e4135a85469d535553db28a4ddb2311a02ccbe81d480fc2c2c0b6738472d53ce7a4be6f5d2a5fa2950f8be7aacecd41fee04e5547bb4ea0c8691a147a1ccd7988b873becb676b61196be1da4bd32572b12d91b01410b7a2d6094bb8025613584c5deda2097ad8b1a015ff7b0043007e3dedcde7cf035ff7794542911e787208ad8a43e1ebc4d749b8dc9dfe4ceb53be088dbdac16afdd12b18cf6ba94057ddabc81f320fd9ff2587177b4605b8a137c0f56d3c8170e6ec58b775db8493b14175188143767011a20c39fe37faab55ef170da7736977547de62d7eafb9a7c7127e9d3ed6505b940406638a04ffb7751980c3cc86efebb01ef3ce5668931e55ad82303aaa50498724ba1c2570b9cf416f4a838365d8cab5622944e003841209cd91538120d25ee64e625e3c3aba8aea2a53e84363ad8f2e8d2ccdf1cb386ee766f21c6125af273a06ba6a477ccfafd593c2180d5addfbd271a41c729fa9e77a8f4a041d067c2c08974571926f3b4daee85bd6ffb25d55dbc0581d5b60adfc2d8136d4ab555cb4c6c131e97654f8c6501e4eb3cb73dcd501c05bf8fe1558f5e237d6fa1901a33cf00da686e7cf4c6db89758637c25b709114e91bed58b8812a85956d851c0b013817cfcd86a5aa8be7839b441b64eefd6849d831545f70a5b77913e5cd20c0a07de5463942ee08c87988a05de4171b3a6aadfcd5cd2f0503dce5cd370793c12e19b2b3e34cbbca70100b10a6997e676e30bfbea5aba1bce886026442fd79d1d113347dd1ccd4e81f0b035fe4a944715f7978660701f1517243d79d4846fb7ccaec4dcb956543eae8b1fa68dc2828914f44198e3519704593bda3a4dfe54eb937073e0e398bc1b5bc834e27826bb88a2bf0b89a1bc763a572d1ac8508d006f69a59d0ed395ae1d6aab5ee7a4391d90acb2219ad69e10b72dcd0935f2a1e664c453e319fb07a2b331e554c277ef36b7211cb34f1bfb89119dd515d67aacff74ae673e518092689bcb62b8bf47bf5d1404710f405183f417e2091b8af97ede1a801423fd973f80743960cfeebb4957f1829610a47ae11f9ff78cf2d238f5e0b46b45d0853e24dc4a678d6267dd1f6ebbe33c637ba39840c238531d7a9f0543c137bc0eece552d42642d1bab31707ca3b3663d9c7a81ac3b270a4780e702ad3aaec79d8986730d2b52844bc5d63b411678a3d916a0d5969dfb40b77b67b1a3a278d2837eda191ed85420d1c7a531f9309c5fe1443d80546c220bd0946eeba9757826ba5e7426b3e24a21b41e14cb32807a3826f3046ac041ffb9ff7a1f4c0db3ef959395d0460f93e05c21956011558da2b285d5bfd954011b5a8816f35338b6fbbd177e9c5e3d2812ac8995fee6f2ed452441de7d6175b0300c1fb63e8177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b8806439ba03f0d1818813a276e01b5c3141798e3659d8515a454eb482ce5db68b3980337373f13734723cc36b50f907b536d32eace265d31efd4734210f2cbbce8fbd50fb6359c2c575c3831d1c26a5473a3c9598109c5ed95ea787a27e3297a3b1cda0fb6359c2c575c3831d1c26a5473a3c9598109c5ed95ea787a27e3297a3b1cda0fb6359c2c575c3831d1c26a5473a3c9598109c5ed95ea787a27e3297a3b1cda0fb6359c2c575c3831d1c26a5473a3c9598109c5ed95ea787a27e3297a3b1cdaf34dadff99cd9e875b43f625dda6f2dd35893486fe55fd7ae05556b8b74d752ea53f8ad1fec8d8e847b41133a410a58589e80169d511d95513cc79d23e4ef7570ec37c79650a2dd8733cb915c61ae9681ed62452063f0d296c59902d53040ec0f34dadff99cd9e875b43f625dda6f2dd35893486fe55fd7ae05556b8b74d752ee2dec4240fa055f7dde22bdd40a8b28fbcd448ea4807ef138e611270a11aba1f06d30794f8735783e952a826ff461ea9fe0e6eacdf5869dd9979769f0f79b8735a57b4bf492d21c418c9529a10925d219c14ac25b4cc35ac86d78c56adc3ce4152b531bda65513a37b0cb352dd127acfc3a6a8ecc80cfdbc51757ef1e72c71e04f610dd4ec27af590d81e6b2d0d03e7a03b9b539dbc0632d70180d728c78e431nmtuinmtuinmtuino-wait.d/90-nm-cloud-setup.shQrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootNetworkManager-1.22.10-150200.3.18.1.src.rpmNetworkManagerNetworkManager(aarch-64)config(NetworkManager)dhcdbdlibnm-device-plugin-adsl.so()(64bit)libnm-device-plugin-bluetooth.so()(64bit)libnm-device-plugin-ovs.so()(64bit)libnm-device-plugin-team.so()(64bit)libnm-device-plugin-wifi.so()(64bit)libnm-device-plugin-wwan.so()(64bit)libnm-ppp-plugin.so()(64bit)libnm-wwan.so()(64bit)@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@      /bin/bash/bin/sh/bin/sh/bin/sh/bin/sh/bin/shNetworkManager-brandingconfig(NetworkManager)dhcp-clientiproute2iputilsld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libbluetooth.so.3()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.26)(64bit)libcurl.so.4()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgmodule-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libjansson.so.4()(64bit)libmm-glib.so.0()(64bit)libndp.so.0()(64bit)libnewt.so.0.52()(64bit)libnewt.so.0.52(NEWT_0.52)(64bit)libnewt.so.0.52(NEWT_0.52.13)(64bit)libnewt.so.0.52(NEWT_0.52.6)(64bit)libnewt.so.0.52(NEWT_0.52.9)(64bit)libnm-wwan.so()(64bit)libnm.so.0()(64bit)libnm.so.0(libnm_1_0_0)(64bit)libnm.so.0(libnm_1_10_0)(64bit)libnm.so.0(libnm_1_10_2)(64bit)libnm.so.0(libnm_1_12_0)(64bit)libnm.so.0(libnm_1_14_0)(64bit)libnm.so.0(libnm_1_16_0)(64bit)libnm.so.0(libnm_1_18_0)(64bit)libnm.so.0(libnm_1_20_0)(64bit)libnm.so.0(libnm_1_22_0)(64bit)libnm.so.0(libnm_1_2_0)(64bit)libnm.so.0(libnm_1_4_0)(64bit)libnm.so.0(libnm_1_6_0)(64bit)libnm.so.0(libnm_1_8_0)(64bit)libnspr4.so()(64bit)libnss3.so()(64bit)libnss3.so(NSS_3.2)(64bit)libpolkit-agent-1.so.0()(64bit)libpolkit-gobject-1.so.0()(64bit)libpsl.so.5()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)libreadline.so.7()(64bit)libselinux.so.1()(64bit)libsmime3.so()(64bit)libsmime3.so(NSS_3.2)(64bit)libsmime3.so(NSS_3.4)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libsystemd.so.0(LIBSYSTEMD_221)(64bit)libteamdctl.so.0()(64bit)libudev.so.1()(64bit)libudev.so.1(LIBUDEV_183)(64bit)libuuid.so.1()(64bit)libuuid.so.1(UUID_1.0)(64bit)mozilla-nssppprpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysconfig-netconfigsystemdsystemdsystemdsystemdwpa_supplicant1.22.10-150200.3.18.12.4.73.0.4-14.6.0-14.0.4-14.0-15.2-10.80.50.6.44.14.1bgbN@b\@aK`@`pA`\{@_@^@^j$@^h^K^:@^4^,-^g@^@^]@]@]µ]]]]]]]@1@\\t@\@\ޢ@\@\|\@\6\r@\R@[@[S@[j@[t[.[:@[v[Y[&M@Z(ZZK@ZZkZZ@ZZH@ZxG@Zk@ZiZhu@Z8@Z+@Z!D@YY@YdY_wY^&@Y0Y.@YXQ@XBX6@XAXXXU(XU(XS@WSWށWu@W@W@W@W@W@W@WWL+@W@WV@VbVV@VVV @VzVTQ@U@UoU@UL@UL@UK@UJ@UT@TܕT}TTq@TTO@songchuan.kang@suse.competr.pavlu@suse.comsongchuan.kang@suse.comsongchuan.kang@suse.comsongchuan.kang@suse.comsongchuan.kang@suse.comsongchuan.kang@suse.comhpj@urpla.netsongchuan.kang@suse.combjorn.lie@gmail.comwerner@suse.debjorn.lie@gmail.commgorse@suse.combjorn.lie@gmail.comdimstar@opensuse.orgbjorn.lie@gmail.comdev@stellardeath.orgbjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.comdimstar@opensuse.orgbjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.comsckang@suse.comsckang@suse.combjorn.lie@gmail.comsckang@suse.comsckang@suse.comsuse-beta@cboltz.dealarrosa@suse.comsckang@suse.comjengelh@inai.debjorn.lie@gmail.comsckang@suse.comsckang@suse.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.comdevelop7@develop7.infosckang@suse.combjorn.lie@gmail.combjorn.lie@gmail.combjorn.lie@gmail.comlnussel@suse.debjorn.lie@gmail.comsckang@suse.comdimstar@opensuse.orgdimstar@opensuse.orgfabian@ritter-vogt.deseife+obs@b1-systems.comdimstar@opensuse.orgsckang@suse.comdimstar@opensuse.orgbjorn.lie@gmail.comdimstar@opensuse.orgbjorn.lie@gmail.commgorse@suse.compavlix@pavlix.netyfjiang@suse.comsckang@suse.comzaitor@opensuse.orgsckang@suse.comzaitor@opensuse.orgdimstar@opensuse.orgsckang@suse.comtchvatal@suse.comtchvatal@suse.combholst@lusku.dedimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgzaitor@opensuse.orgdimstar@opensuse.orgzaitor@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgsckang@suse.comfcrozat@suse.comsckang@suse.comsckang@suse.combadshah400@gmail.comsckang@suse.combadshah400@gmail.comzaitor@opensuse.orgdimstar@opensuse.orgdamjanovic.ivo@gmail.comdimstar@opensuse.orgzaitor@opensuse.orgsimon@simotek.netdimstar@opensuse.orgbastianholst@gmx.deglin@suse.comdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgdimstar@opensuse.orgglin@suse.comdimstar@opensuse.orgdimstar@opensuse.orgbadshah400@gmail.comsfalken@opensuse.orgarvidjaar@gmail.comdimstar@opensuse.org- Add 0001-supplicant-interface-Match-more-ciphers-to-determine.patch: supplicant/interface: Match more ciphers todetermine AP security (glfo#NetworkManager/NetworkManager/commit/e0191320, bsc#1198381);- Add 0001-rdisc-fix-parsing-ndp_msg_opt_dnssl_lifetime-from-IP.patch: rdisc: fix parsing ndp_msg_opt_dnssl_lifetime() from IPv6 RA (bsc#1195222). - Add 0001-ndisc-don-t-artificially-extend-the-lifetime-of-DNSS.patch: ndisc: don't artificially extend the lifetime of DNSSL/RDNSS options (bsc#1195222).- Add NetworkManager-RFC8106.patch: Backport upstream fixes to implement RFC 8106(glfo#NetworkManager/NetworkManager#874, bsc#1195173).- Drop nm-add-CAP_CHOWN-capability.patch: This solution was denied by upstream maintainers.- Add nm-add-CAP_CHOWN-capability.patch: Add CAP_CHOWN to CapabilityBoundingSet to make teamd work properly (glfo#NetworkManager/NetworkManager!860, bsc#1185424).- Add nm-fix-dhcp-client-timeout.patch: Better handle dhclient's timeout so that a recorded lease can be used when dhcp server is down(glfo#NetworkManager/NetworkManager!811, bsc#1183202). - Modified NetworkManager.conf: Use dhclient as the default dhcp client(glfo#NetworkManager/NetworkManager!811, bsc#1183202).- Add NM-restore-MAC-on-release-only-when-cloned.patch: bond: restore MAC on release only when there is a cloned MAC address (glfo#NetworkManager/NetworkManager!775, bsc#1183967).- Exclude systemd.automount from nfs processing: fix boo#1116625 as suggested from Neil Brown- Rebase nm-add-CAP_SYS_ADMIN-permission.patch.- Update to version 1.22.10: + core: periodically cleanup stale device state files from /run. + dhcp: fix crash in nettools client. + bond: fixed the validation of the miimon option. + Various minor bug fixes and improvements.- Modify nfs script (boo#1164642) * Also mount nfs4 shares * Ignore nfs or nfs4 shares in case if the noauto option is set- Update to version 1.22.8: + Added configuration option to customize IPv6 RA timeout. + Internal DHCP client will now request a lease renewal using the previously obtained IP address when expired. + Removed length limitation for OVS Bridge, Patches and Interfaces (only Patch types) names. + Fixed initialization of 'secs' DHCP header field, this caused some DHCP relays to drop packets. + Fixed failure when creating team interfaces using 'nmstate'. + Various bug fixes and improvements.- Add -fcommon to CFLAGS. This is currently being done upstream (boo#1160381).- Update to version 1.22.6: + Various fixes for the internal DHCP client. + Slave devices now do not get created/activated if master is missing. + Fixed 'startup-complete' bug where NetworkManager would reach the network-online.target even when not all the connections had been tried. + Updated translations.- No longer recommend -lang: supplements are in use- Update to version 1.22.4: + Fix behavior of internal DHCP client when the server sends a NAK. + Support 31-bit prefixes on IPv4 point-to-point links according to RFC 3021. + Fix memory leak parsing RequestScan D-Bus method arguments.- Fix 'nfs' dispatcher script It was checking for an enabled unit 'nfs.service' - which does not exist (anymore?). Switched to a check for an enabled unit 'nfs-client.target'- Update to version 1.22.2: + Fix multiple issues in the internal DHCP client, including wrong parsing of search domains and classless routes options, and failures in obtaining and renewing the lease with certain server configurations. + Export NM_CAPABILITY_OVS capability on D-Bus and in libnm to indicate that the OVS plugin is loaded. + Fix libnm annotations for nm_sriov_vf_get_vlan_ids() to allow the usage of the function through GObject introspection.- Update to version 1.22.0: + Drop support for BlueZ 4. BlueZ 5 was released in 2012 and should nowadays be available everywhere. + DHCP: switch "internal" DHCPv4 plugin from code based on systemd to use nettools' n-dhcp4 library. + Add support for "scope" attribute for IPv4 routes. + Add support for specifying IAID and FQDN flags for DHCP request. + Add a '802-1x.optional' property to consider the wired 802.1X authentication as optional. + Use the Network Cost Wi-Fi information element to determine metered device state. + Support main.auth-polkit=root-only setting to disable PolicyKit use and restrict authorization to root user. + core: declare "startup complete" when device reaches "connected" state, even if IP addressing methods did not yet fully complete. This changes behavior for unblocking "NetworkManager-wait-online.service", and "network-online.target" earlier. If this causes issues in your setup, you may need to configure "ipv4.may-fail=no" or "ipv6.may-fail=no", which delays reaching "connected" state for the address family accordingly. + libnm: hide NMObject and NMClient typedefs from header files. This prevents the user from subclassing these types and is an ABI change (in the unlikely case that a user was subclassing the types, which is no longer supported). + libnm: retire deprecated WiMAX API NMDeviceWimax and NMWimaxNsp. WiMAX support was removed from NetworkManager in version 1.2 (2016) and no such type instances would have been created by NMClient for a while now. + Deprecate synchronous API for D-Bus calls in libnm. We don't remove libnm API so you are free to continue using it. But tells you that using it might be a bad idea. + libnm: heavily internal rework NMClient. This slims down libnm and makes the implementation more efficient. NMClient should work now well with a separate GMainContext. + Add `nmcli general reload` subcommand to reload NetworkManager configuration and DNS settings. + nm-cloud-setup: add new tool for automatically configuring NetworkManager in cloud. This is still experimental and currently only EC2 and IPv4 is supported. + Add new NetworkManager logo to "contrib/art/logo". + Various bug fixes and improvements. - Disable networkmanager-checks-po.patch: Needs rebase. - Add new nm-cloud-setup.service to pre/post/preun/postun calls.- Update to version 1.20.8: + Fix handling of system CA certificates in the ifcfg parser. + Handle ReachableTime and RetransTimer from IPv6 Router Advertisements. + Fixed setting of MTU according to its parent device for some device types. + Various fixes for the initramfs configuration genertor.- Update to version 1.20.6: + Fix updating agent-owned VPN secrets. + Adjust IWD support to new D-Bus path of IWD 1.0. + Introduce an 'optional' property in the 802-1x setting to allow the activation to proceed in case of missing authenticator. + Fix ARP announcements for IP addresses configured on interfaces. + Use proper interface when adding s390 specific details in initrd generator. + Don't disable PMF on Wi-Fi connections using SAE. + Properly handle uint16 property types in libnm.- Drop NetworkNanager-client recommends: this is no longer needed, as NM itself ships a frontend by now (nmtui). If a DE has a better way to manage NM (by means of applets or other way of integration) it is up to the DE to depend on the applets.- Update to version 1.20.4: + Fix crash related to Wi-Fi-P2P. + Support rd.znet option in initrd generator to support s390. + Fix not creating default-wired-connection when a suitable profile exists which is not tied to the device by interface-name. + tui: support WPA3-Personal (SAE). + Fixes for OLPC Mesh Wi-Fi. + Various bug fixes. Notably, fix unit test and build issues. - Drop nm-fix-gtk-doc.patch: Fixed upstream.- Add nm-fix-gtk-doc.patch: Fix build with gtk-doc 1.32 and newer.- Update to version 1.20.2: + Don't ask wpa_supplicant to attempt to enable FT if the interface doesn't support it. + Various bug fixes and improvements. + Updated translations.- Update to version 1.20.0: + The libnm-glib library, deprecated in favor of libnm since NetworkManager 1.0, and disabled by default since NetworkManager 1.12, has now been removed. + The DHCP client now defaults to "internal". The default can be overriden at build time by using the --with-config-dhcp-default option of the configure script or at run time by setting the main.dhcp option in the configuration file. + Added support for configuring fq_codel line discipline and mirred action. + Added a possibility for distributions to ship dispatcher scripts in /usr/lib. + Drop deprecated setting "main.monitor-connection-files" in NetworkManager.conf. This setting now has no more effect and was disabled by default for a long time. Instead, after changes, load files explicitly with `nmcli connection load` or `nmcli connection reload`. + Rework parsing team JSON config in libnm and stricter validate settings. With this, NetworkManager rejects settings that it considers invalid while still allowing setting arbitrary JSON config directly. + Drop ibft settings plugin. This functionality is now covered by using nm-initrd-generator from initrd to pre-generate in-memory profiles. + Support "suppress_prefixlength" attribute for policy routing rules. + This is what wg-quick uses for the "Improved Rule-based Routing" solution, and the user can now manually configure such policy routing rules. + Support "wireguard.ip4-auto-default-route" and "wireguard.ip6-auto-default-route". This automatically implements the "Improved Rule-based Routing" of wg-quick to help avoiding routing loops when setting the default-route on the WireGuard interface. Note that this is now enabled by default, so there is a change in behavior if your WireGuard connection profiles from before had a default-route (/0) in allowed-ips. + Rework implementation of settings plugins and how profiles are presisted to disk. This is a large internal refactoring of the settings plugins that allows to migrate a connection profile between plugins. + In-memory profiles are now only handled by keyfile plugin and will also be persisted to /run directory. This allows to restart NetworkManager without loosing these profiles and it provides a file-system based API for creating in-memory profiles. + Keyfile plugin now supports a read-only directory of profiles under directory "/usr/lib/NetworkManager/system-connections". Such profiles still can be modified and deleted via D-Bus, which results in writing profiles to /etc or /run that shadow the read-only files. + Add new D-Bus method AddConnection2() that allows to block autoconnect of the profile at the moment when creating the profile. Also add support for this API to libnm. + Add flag "no-reapply" to Update2() D-Bus method. Normally, when a connection profile gets modified, this only changes the profile itself. When the profile is currently activated on a device, then the device's configuration does not update before the profile is fully re-activated or Reapply on the device is called. There is an exception to this: the "connection.zone" and the "connection.metered" properties take effect immediately. The "no-reapply" flag allows suppressing to reapply any properties, so that no changes take effect automatically. The purpose is to really only modify the profile itself without changes to the runtime configuration of the device. + Add "ipv6.method=disabled" to disable IPv6 on a device, like also possible for IPv4. Until now, the users could only set "ipv6.method=ignore" which means the users are free to set IPv6 related sysctl values themselves. + Added support for Wi-Fi Mesh network. - Stop passing --with-libnm-glib to configure, feature was dropped. - Drop sub-packages libnm-util2, libnm-glib4 and libnm-glib-vpn1 and obsolete them from the main package (also in baselibs.conf). - Drop typelib-1_0-NetworkManager-1_0 and typelib-1_0-NMClient-1_0. - Rebase some patches with quilt. - Disable nm-add-CAP_SYS_ADMIN-permission.patch: Needs rework or possibly dropping as the ibft plugin is dropped. - Pass --with-iwd=yes to configure, build experimental IWD backend support. Not recommended for endusers, only for testers willing to take the risk of broken wifi with no support from distro.- Update to version 1.18.4: + Improve handling of externally added policy routing rules and for rules that are taken over after a restart of NetworkManager service. + Fix taking over OVS devices after restart of NetworkManager. + Bugfix reapplying IP configuration while activating. + Allow reapplying Wi-Fi profile when seen-bssids changes. + Various other bugfixes for minor issues and memory leaks. + Various build and test fixes.- Update to version 1.18.2(bsc#1138213): + Add support for policy routing rules. + Add support for VLAN filtering for Linux bridge. + Support ieee-802-1 and ieee-802-3 LLDP TLVs. + Allow large MTU sizes for infiniband/IPoIB connection profiles. + Improve nmcli's handling of list options for connection properties. + Add compatibility with out-of-tree WireGuard module on 5.2 kernels + Fix parsing of BOOTIF= variables in initrd. + Accept numeric IPv4 prefix in place of a mask when parsing a command line in initrd. + Don't check connectivity of unconfigured devices. + Fix PKCS#12 handling in the ifcfg-rh plugin. + Avoid waiting for udev to see software devices created by NetworkManager. + Don't attempt to stop management daemon for Team devices created externally to NetworkManager. + Use FQDN for persistent hostname on Slackware. + Restore IPv6 configuration of a device when its link goes back up. + Fix management status of software devices on system suspend. + Make nmcli not print certificate blobs if --show-secrets is not used. + Fix MTU reapply. - Drop 0001-Update-connectivity-value-on-device-removal.patch: Fixed upstream.- Add nm-add-CAP_SYS_ADMIN-permission.patch: Add CAP_SYS_ADMIN which netconfig needs to call setdomainname (bsc#1129587).- Update to version 1.16.2: + Use FQDN for persistent hostname on Slackware. + Fix wrong permissions of the /var/lib/NetworkManager/secret_key file. + Don't terminate teamd when assuming existing team connections. + Fix incorrect persistence of connections with EAP-TLS and a PKCS#12 certificate when using the ifcfg-rh plugin. + Fix reapply of the MTU property on devices. + Restore IPv6 configuration when the link goes up. + Fix build with sanitizers. + Other various bug fixes and improvements.- Avoid using "systemctl enable" in spec file (bsc#1038403).- Remove legacy checks which fixes bnc#803058 during distribution upgrade from 12.2 to 12.3 in .spec file.- Fix systemd-network-config.patch which added lines starting with "+" to NetworkManager-wait-online.service- Fix the connectivity value of devices which was set to LIMITED when the connectivity check fails. Now if the connectivity is being set to LIMITED but the device state is DISCONNECTED, then the value is coerced to NONE. Add patch submitted to upstream (boo#1103678, glfdo#NetworkManager/NetworkManager#138): * 0001-Coerce-connectivity-LIMITED-to-NONE-when-device-is-d.patch - Fix the global connectivity value which wasn't updated when a device was removed. Which is a problem if the device being removed is the one providing the connectivity. Add patch submitted to upstream (boo#1103678, glfdo#NetworkManager/NetworkManager#141): * 0001-Update-connectivity-value-on-device-removal.patch- Update to version 1.16.0: + Check connectivity per address family. + Support "main.systemd-resolved" to let NetworkManager configure DNS settings in systemd-resolved without making it the main DNS plugin of NetworkManager. + Write "/var/run/NetworkManager/no-stub-resolv.conf" with original nameservers. That is useful with caching DNS plugins like "systemd-resolved" or "dnsmasq" where "/var/run/NetworkManager/resolv.conf" refers to localhost. + Change default "ipv4.dhcp-client-id" setting for the internal DHCP plugin from "duid" to "mac". This is a change in behavior on upgrade when using the internal DHCP plugin (unless the default is overwritten in "NetworkManager.conf" or specified per connection profile). + Improve handling of DHCP router options with internal DHCP plugin. For one, accept multiple routers and add a default-route to each. On D-Bus expose the original DNS and NTP servers without cleaning up local nameservers. + Allow binding a connections lifetime to the DBus client that activated it. + Add support for establishing Wi-Fi Direct connections (Wi-Fi P2P). + Add support for WireGuard VPN tunnels to NetworkManager. D-Bus API and libnm support all options. nmcli supports creating and managing WireGuard profiles, with the exception of configuring and showing peers. + Add initrd generator to be used by dracut and use it as new way of handling iBFT. + Deprecated "plugins.monitor-connection-files" setting in NetworkManager.conf. This option will have no effect in future versions. + Add AP and Ad-hoc support for iwd Wi-Fi backend. + Warn about invalid settings in "NetworkManager.conf". + Support announcing "ANDROID_METERED" DHCP option for shared mode. + Support SAE authentication as used for 802.11s Meshing and WPA3-Personal. + NetworkManager is no longer installed as D-Bus activatable service. + Mark docker bridges as unmanaged via udev rule. + Add new PolicyKit permission "org.freedesktop.NetworkManager.wifi.scan" for controlling Wi-Fi scanning. - Rebase systemd-network-config.patch and nm-dont-overwrite-resolv-conf.patch. - Drop NetworkManager-1.12.2-docker-unmanaged.patch and NM-add-wifi-scan-polkit-rule.patch: Fixed upstream (bsc#1128560).- Do away with em dashes in summaries. - Combine %service_* calls to reduce generated boilerplate.- Update to version 1.14.6: + Fix memory corruption in internal DHCPv6 client (CVE-2018-15688). + No longer limit number of search entires in resolv.conf to 6. + Support restricting NetworkManager.conf device configuration based on used DHCP plugin. + Add "${MAC}" specifier for connection.stable-id. This uses the current MAC address for seeding the stable generation of MAC address, DHCP client-id or IPv6 stable-privacy interface identifier. + Support special value "duid" for "ipv4.dhcp-client-id". This generates an RFC4361-compliant client-id like the internal DHCP client used to do by default. Previously, there was no explicit name for such a client-id and it was not usable with dhclient DHCP plugin. This also generates the same client-id as systemd-networkd does by default. + Support and use a new kind of secret-key in "/var/lib/NetworkManager/secret_key". The secret-key represents the identity of the machine that is used for various purposes like generating IPv6 stable privacy addesses. It is now combined with "/etc/machine-id" so that changing only the machine-id results in new identifiers. That matters for example when cloning a virtual machine. Previously, the user hard to prune NetworkManager's secret-key to get a new identity, now regenerating machine-id suffices. Secret-keys generated by earlier versions of NetworkManager are not affected and keep their previous behavior. + Fix the DHCP client-ids based on the MAC address of IPoIB/infiniband devices. + Fix restoring IP configuration after interface went down. + No longer let NetworkManager touch rp_filter setting. The rp_filter sysctl must now be set outside of NetworkManager according to the admin's preference. Note that a strict rp_filter may break valid use-cases and interacts badly with connectivity checking. + Various bug fixes and improvements.- Add NM-add-wifi-scan-polkit-rule.patch: Adding a new polkit action "org.freedesktop.NetworkManager.wifi-scan" so that distributions can add specific rule to allow Wi-Fi scans (bsc#1122262, glfo#NetworkManager/NetworkManager!68).- Modify nfs script: Only mount/unmount when the file type is nfs (bsc#1074074, bsc#1146935).- Update to version 1.14.4: + Fix a crash in nmcli when a device is removed while being disconnected. + Fix a crash in ifupdown (Debian) configuration plugin. + Fix a daemon crash when a generated connection doesn't validate. + Fix a memory leak in dhclient DHCP plugin. + Fix line editing in nmcli password prompts. + Fix a RPATH in bluetooth and wwan plugin when built with Meson (otherwise they wouldn't find libnm-wwan.so).- Update to version 1.14.2: + Fix a bug that could cause NetworkManager to crash after checking connectivity status. + Correctly apply a default (-1) metric from DHCP. + Multiple fixes for IWD Wi-Fi backend. + Multiple fixes for builds with Meson build system. + Fix a crash with OLPC XO-1 mesh Wi-Fi. + Fix handling "serial.parity" and "serial.send-delay" properties in nmcli. + Improve auto-selecting device when activating a connection profile and don't auto-select unmanaged devices when activating multi-connect profile. + Avoid expiring the lifetime of IPv6 addresses from router advertisements.- Update to version 1.14.0: + Added support for IEEE 802.15.4 and 6LowPAN devices. + Support activating profile multiple times via connection.multi-connect setting. + Add match setting to restrict a profile to devices based on a list of interface names with globbing supported. + Fix PrimaryConnection for VPN with default-route. + Add support for ethtool offload features. + Add support for configuring llmnr. + Deprecate endian-dependent D-Bus API and add new API that can be used instead (rh#1153559). + Add support for ip6gre/ip6gretap IP tunnels. + Add support for detecting WireGuard interfaces (WireGuard VPN cannot be controlled via NetworkManager). + Add support for configuring SR-IOV devices. + Improve error reporting of activation when no device is available. + Support reapplying changes of the route metric. + Support EAP profiles with iwd Wi-Fi backend and support iwd API 0.8. + Expose slaves of OVS bridges and ports.- Add NetworkManager-1.12.2-docker-unmanaged.patch: Do not manage Docker bridge interfaces (glfdo#NetworkManager/NetworkManager!15)- Update to version 1.12.4: + Fix crash in connectivity check. + Fix accepted input format for vpn.secrets in nmcli's password file. + libnm: support private keys encrypted with AES-{192,256}-CBC. + Fix stopping pppd on modem hangup + Various minor bugfixes and translation updates. - Drop NetworkManager-fix-compile-error.patch and NetworkManager-remove-assertion.patch: Fixed upstream.- Add NetworkManager-fix-compile-error.patch: Fix compile error due to NM_AVAILABLE_IN_1_12_2 macro. - Add NetworkManager-remove-assertion.patch: cli: remove assertion in nmc_device_state_to_color() (bgo#796834).- Update to version 1.12.2: + Fix missing symbols in libnm ABI for settings. + Fix a regression that disallowed activations of VPN connections with a device specified. + Robustness fixes to connectivity checking. - Changes from version 1.12.0: + Improved support for configuration checkpoint, including support in libnm. + Added capability to set IP Tunnel configuration flags. + The systemd-resolved DNS plugins now supports MDNS. + Systemd-resolved and dnsmasq DNS plugins now honor the DNS priority setting (CVE-2018-1000135). + Wi-Fi devices now support FILS for speedier roaming support. + Drop dependency on libnl3 library. + Add support for "onlink" routes. + More robust connectivity checking. + Dropped the obsolete "ifnet" settings plugin, + Try harder to generate reasonable human-readable names for devices even if the hwdb contains garbage. + Add an "overview" option to hide default values in nmcli, resulting in more concise output. + Reworked the inner workings of D-Bus interface for better resource efficiency. + Add support for configuring nmcli coloring via terminal-colors.d(5). + Added experimental support for Meson build system. + Added initial IWD Wi-Fi daemon support. + A non-hexadecimal DHCPv4 client-id is now properly passed to dhclient with the first byte (type) set to zero, as stated in the documentation. This represents a change in behavior since previous versions where the first character of the string was used as type. The internal client is not affected by the change. + DNS setting rc-manager=file now always follows dangling symlinks instead of replacing /etc/resolv.conf with a plain file. + Added wake_on_wlan connection setting to configure wake-on-wireless-lan (WoWLAN). + The libnm-glib library, deprecated in favor of libnm since NetworkManager 1.0, is now not built by default. While it can still be enabled, the distributions should have a good plan for removing it if they need to keep shipping it at this point. + Nmcli now scans for Wi-Fi networks before displaying them, if the last scan was too long ago. + Added the ipv6.dhcp-duid property to allow configuring the DHCPv6 DUID. + Extended ipv6.dhcp-client-id property to support DHCP client identifers depending on the MAC address and the stable ID. + Set NM_DISPATCHER_ACTION environment variable in dispatcher scripts. - Rebase NetworkManager-1.10.6-netconfig.patch and systemd-network-config.patch with quilt. - Disable networkmanager-obs-net.patch and make check, needs rebase. - Pass with-libnm-glib to configure, deprecated libnm-glib support is no long built by default, and since we can not remove this yet due to Steam, we pass this option for now.- Update to version 1.10.10: + Fix crash during reapply of connection settings. + Minor bugfixes.- Don't fall back to writing /etc/resolv.conf if launching netconfig fails for some reason (boo#1092352, NetworkManager-1.10.6-netconfig.patch).- Update to version 1.10.8: + Fix connectivity timeout handling (bgo#794464). + Retry activating devices when the parent becomes managed (rh#1553595). + Correctly set the rp_filter value (rh#1565529). + A fix to ensure teamd is respawned after daemon restart (rh#1551958). + Better handle DHCP expiry (bgo#783391). + Fix configuration of IPv6 over master interfaces (rh#1575944). + Other various bug fixes including possible crashes. + Updated translations. - Drop NM-look-at-all-rp-filter-value.patch: Fixed upstream.- Add NM-look-at-all-rp-filter-value.patch: look at 'all' rp_filter value too to determine actual value (bsc#1084336, bgo#794689).- Unconditionally enable translation-update-upstream: on Tumbleweed, this results in a NOP and for Leap in SLE paid translations being used (boo#1086036).- Update to version 1.10.6: + ovs: fix compilation issue of OVS plugin and various fixes. + team: add support for team runner "random". + core: cleanup activation of device (rh#1537160). + dhcp: retry indefinitely to renew the lease (rh#1503587). + core: fix blocking autoconnect for no-secrets (bgo#794014). + libnm: mark async results as cancelled (bgo#794088). + Various bug fixes including possible crashes. + Updated translations. - Drop nm-preserve-agent-owned-secrets-on-connection-update.patch, NetworkManager-1.10.4-buildfixes.patch and nm-fix-autoconnect.patch: fixed upstream.- Add nm-fix-autoconnect.patch: Fix autoconnect with agent-owned secrets (bgo#794014, boo#1079672).- fix nfs dispatcher script (boo#1083831)- Modernize spec-file by calling spec-cleaner- Add nm-preserve-agent-owned-secrets-on-connection-update.patch: Backport upstream commit to preserve agent-owned secrets on connection update (bgo#793324, bsc#1082762).- Update to version 1.10.4: + Load jansson at runtime. This solves a clash with json-glib that caused a gnome-control-center crash, but also gets rid of a hard dependency. + Correct nmcli exit values after receiving a signal. + Fix libnm secret agent asynchronous initialization. + Add a default route for a modem even if it didn't sent a gateway. + Improve communication of DAD failures. + Remember device default metrics across daemon restarts. + Various bug fixes including possible crashes. + Updated translations. + Add NetworkManager-1.10.4-buildfixes.patch: Fix OVS compile errors (bgo#793183).- Replace sysconfig with sysconfig-netconfig BuildRequires and Requires, this is what we in reality need.- Update to version 1.10.2: + Added support for 'onlink' IPv4 routes attribute. + Wait longer for the carrier to come up after a MTU change. + Implemented abstraction for team connections that exposes team configuration items as distinct properties. + Added basic support for tc queueing disciplines and filters. + Introduced an Update2() D-Bus method to update connection settings with more flexibility. + Many bug fixes and improvements. - Changes from version 1.10.0: + NetworkManager includes now basic OpenVSwitch support, good enough to be capable of setting up simple OpenVSwitch configurations. + Added support for activating PPP connections on non-Ethernet interfaces. + It is now possible to authenticate to a Wi-Fi network using WPS (Wi-Fi Protected Setup). + Implemented support for Wi-Fi PMF (Protected Management Frames, 802.11w), which can be configured via the wifi-sec.pmf property. + Now the maximum rate of wireless access points supporting 802.11 is properly calculated and exposed on D-Bus. + Background scanning is now disabled for non-WPA-Enterprise Wi-Fi networks. + Added support for the Bluetooth NAP (Network Access Point) profile. + Added support for disabling connectivity checking via the D-Bus interface. + The internal DHCP client now understands the domain-search option. + Bridge connections support the group-forward-mask property. + NetworkManager can now configure multiple IPv6 default routes received through RA and each gets configured with the announced preference. + It is possible to specify the routing table for each static route. + Support specifying a explicit routing table for any non-static-route, including routes from DHCP, device-routes, IPv6 autoconf. + Device are left configured when a user sets them as unmanaged by NetworkManager. + New connection.auth-retry property to configure how often authentication is prompted before failing the configuration. + The platform code that handles synchronization with kernel status via netlink has been reworked and is more efficient. + Allowed the update of connections that have an associated ifcfg-rh routing rules file. + Non-UTF8 properties are now escaped when they are exported on D-Bus. + NetworkManager-wait-online.service now starts NetworkManager.service if needed. + The MAC address for bond connections can be changed in nmtui. + Fixed dependency problems when setting the MTU of VLAN and master devices. + The systemd-resolved DNS plugin properly handles the DNS priority setting. + Fixed setting a DHCP timeout greater than 60 seconds (dhclient). + Fixed some memory leaks. + Many other bug fixes and improvements. - Rebase networkmanager-obs-net.patch and nm-dont-overwrite-resolv-conf.patch. - Drop nm-disconnect-proxy-signals.patch and nm-vpn-remote-connection-disconnect-signals.patch: Fixed upstream.- Update to version 1.8.6: + Fix a daemon crash on permission check (bgo#787897). + Fix a daemon crash on VPN state change (bgo#787893). + Fix a nmcli crash in interactive mode's describe command (bgo#788104). + Fix termination of the nmcli interactive mode (rh#1517401). + Properly handle route metric of zero in keyfiles. + Add support for DSA switch devices (rh#1371289). + Fix a memory leak of connection D-Bus objects (rh#1461643). + A double close that could potentially race with the D-Bus thread reusing the same file descriptor (rh#1451236). + Connectivity check fixes (bgo#785281) (bgo#784629). + Fix the metered properties handling in libnm. + Avoid dropping agent secrets unnecessarily (bgo#789383). + Fix the asynchronous initialization of a secret agent in libnm. - Drop nm-disconnect-proxy-signals.patch and nm-vpn-remote-connection-disconnect-signals.patch: Fixed upstream. - Minor spec cleaning, tweak spec to silence a few rpm lint warnings. - Replace addFilter("dbus-policy-missing-allow") with addFilter("dbus-policy-allow-without-destination"), filter out the current rpmlint warning. - Add addFilter("suse-branding-unversioned-requires*") to rpmlintrc, we have this unversioned on purpose. - Add addFilter("systemd-service-without-service_add_post NetworkManager-wait-online.service") addFilter("systemd-service-without-service_add_pre NetworkManager-wait-online.service") addFilter("systemd-service-without-service_del_postun NetworkManager-wait-online.service") addFilter("systemd-service-without-service_del_preun NetworkManager-wait-online.service") to rpmlintrc, filter out warnings we do not care about nor want as we do not want to enable this service by default. - "Mark" %%{_sysconfdir}/dbus-1/system.d/org.freedesktop.NetworkManager.conf and %%config %{_sysconfdir}/dbus-1/system.d/nm-dispatcher.conf as config files in spec, silence rpmlint.- Add nm-disconnect-proxy-signals.patch: disconnect proxy signals when closing; fixes possible crash when opening the user panel (bgo#787897). - Add nm-vpn-remote-connection-disconnect-signals.patch: disconnect signal handlers when remote/vpn connections are disposed; fixes a gnome-control-center crash (bsc#1073472 bgo#787893).- Remove reference to deprecated and dropped ifcfg-suse plugin from configuration.- Switch to python3: + Replace BuildRequires python-gobject, python2-dbus-python with python3-gobject, python3-dbus-python. + Explictly set environment variable PYTHON as python3 in build time.- Modify nm-dont-overwrite-resolv-conf.patch: make netconfig call an atomic action, don't kill it after 2000ms (bsc#960153).- Update to version 1.8.4: + No longer install NetworkManager-wait-online.service in network-online.target.wants directory (rh#1455704). + Fix nmcli device connect wifi for APs that support both WPA-PSK and WPA-EAP (rh#1492064). + Fix crash unregistering object manager in libnm on restart of NetworkManager. + Improve handling externally managed slaves devices. + Don't reset MAC address of software devices to fake permanent address. + For dhclient use "timeout" option in configuration file, instead of the command line option which is only supported by downstream. + Perform the public-suffix check only for the hostname-derived domain. + Fix memory leak in connectivity check. + Better restore device managed state on rollback of checkpoint. + Skip addition of default-route if it already exists. + Bug fix detecting error condition when deleting route in platform. - Drop NM-dhcp-improve-parsing-interface-statement.patch: Fixed upstream.- Add NM-dhcp-improve-parsing-interface-statement.patch: Fix NM not writing DNS servers to /etc/resolv.conf (boo#1047004).- Update to version 1.8.2: + Fix bug blocking startup wrongly waiting for carrier. + Fix handling of non UTF-8 strings in libnm and fix non NUL terminated string. + Handle DNS priority for systemd-resolved DNS plugin. + Fix assuming master devices as they wait for slaves to activate. + Fix reading managed state from device state file. + Fix crash activating bluetooth or WWAN connection. + No longer add a direct route to the DHCP server. + Several bug fixes and improvements.- Call autogen.sh networkmanager-obs-net.patch touches the build system.- Add nm-dont-overwrite-resolv-conf.patch: Fix NetworkManager overwriting /etc/resolv.conf (bsc#960153, bsc#1021665).- Disable 6 of the tests that are failing on OBS runs * networkmanager-obs-net.patch- Version update to 1.8.0: * Default routes set by devices that failed connectivity checks are now penalized with a higher metric * nmcli is now able to produce output more friendly for machine parsing * The slaves available at the time a master connection is activated are enslaved in a stable order, making the automatic MAC address for Bonding devices more predictable. * Hostname management is now more flexibly configured * Support for additional route options (pref-src, src, tos, window, cwnd, initcwnd, initrwnd, mtu, lock-window, lock-cwnd, lock-initcwnd, lock-initrwnd, and lock-mtu). * Fixed detection of EAP-FAST support in wpa_supplicant * Support for handling PINs for PKCS#11 tokens as secrets * GSM and CDMA connections now have a MTU property * An option to disable selected TLS versions during EAP phase 1 authentication * The 802.1x authentication timeout is now configurable to allow a faster fallback to other connections * Persist managed state of device until reboot. This improves seamless take over of a previously managed device after restart of NetworkManager. * Better handle devices that are externally managed by somebody else by consistently generating an in-memory connection to reflect the external state. * Expose SRIOV capability of a device on D-Bus and support configuring the number of virtual functions via NetworkManager.conf. * Support matching networking devices via new "driver:" device spec in NetworkManager.conf. * Introduced support for creating and managing dummy links * The teaming devices now support setting a hardcoded MAC address * Settings of bonding devices can now be modified on-the-fly, without the need to reactivate a connection * The failures to activate a connection now communicate better error responses to nmcli * Reverse Path filtering is now disabled in multihoming configurations where it would interfere with legitimate network traffic * libcurl is used instead of libsoup for connectivity checking, resulting in a smaller dependency footprint * With DNS mode "rc-manager=symlink", don't write /etc/resolv.conf as a symlink if it already exists as a regular file. * Support attaching user-data in form of key-value pairs to connection profiles. * Fix accpeting fully qualified name for ipv4.dhcp-hostname setting. * Make NetworkManager more forgiving to failure to change the MAC address during scanning. - Wimax switches are completely removed - Added dependencies on packages with versions to ensure all features are properly detected, configure reports yes for most items now * add libcurl * add libpsl * add python-dbus test dep - Remove gudev and soup deps as per upstream changes - Enable testsuite - Add patch networkmanager-checks-po.patch: * Our patch added new .in file that needs to be excluded from translations- Replace nfs NetworkManager dispatcher script. Issues of the old nfs dispatcher script, fixed by this commit: + It only mounts NFS shares with auto-mount. In SUSE's default configuration, those are tried to be mounted at boot. Unfortunately, this would not work, when NetworkManager handles the connection later. The boot process stops at this point. + It unmounts everything on each "down" for any network interface, even if the NFS share is still connected to the computer via another network interface.- Update to version 1.6.2: + Fixed build warnings with GCC 7. + Multiple bug fixes in NetworkManager, nmcli and nm-online including several crashes.- Update to version 1.6.0: + No further changes since rc2 (1.5.91).- Update to version 1.5.91: + Bugs fixed: bgo#777402, rh#1406454, rh#1414186.- Update to version 1.5.90: + Avoid reading the permanent MAC address before the device is initialized by UDEV. This avoids a race where NetworkManager might detect the MAC address of the wrong interface. + Fixed race conditions when renaming interfaces, for example as done by UDEV for persistent interface naming. This could cause detecting devices as the wrong hardware type. + Added initial support for PKCS#11 tokens with 802.1x authentication. + The stable-addressing for MAC address randomization and RFC7217 IPv6 stable privacy addressing can now be more flexibly configured using dynamic randomization seeds in "connection.stable-id". + Added support for managing the MACsec links. Requires support in wpa_supplicant (version newer than 2.6). + When the master of Team, Bridge and Bond devices is specified as a connection UUID, the ifcfg-rh plugin now writes the master connection's interface name into the ifcfg file for improved compatibility with the legacy network service. + Improve handling of MTU by resetting the previous MTU when the device deactivates and reset the MTU to a defined value on activation. + Improve tracking of parent devices for dependend devices like ip-tunnels, MACVLAN, VETH, VLAN, and VXLAN. + Many bug fixes and improvements.- Update to version 1.5.3: + The cloned.mac-address property can now be used with Bond and Bridge devices. + The ifcfg parsing code has been reworked for better compatibility with actual shell variable files. + The ipv6.method=shared is now supported, utilizing DHCPv6 Prefix Delegation option to obtain prefixes for the interface. + nmtui now supports creating and editing IP tunnel connections. + The libnm client library now uses the D-Bus ObjectManager API that allows for quicker initialization of the clients. + nmtui now utilizes the asynchronous libnm client API to paralellize communication with the daemon, reducing the client startup time. + Ethernet devices now use "802-3.speed" and "802-3.duplex" properties to allow controlling overriding the negotiated link parameters. + Order in which IP addresses are configured is now preserved so that primary address is selected correctly. + The PPP manager can now be split into a separate package. + Details of the DNS information obtained from the connections is now exposed on the D-Bus and can be inspected with nmcli. + Added the support for DHCPV6_HOSTNAME and DHCPV6_SEND_HOSTNAME keys in ifcfg files that control "dhcp-hostname" and "dhcp-send-hostname" properties of the "ipv6" setting. - Add python-gobject BuildRequires: needed in order to build the settings documentation.- Update to version 1.5.2: + Introduced Vala bindings for libnm. + NetworkManager would now keep most connections up on shutdown (except Wi-Fi connections, VPN connections and other kinds that can't be assumed on startup) + The checkpoint/restore connection can now also remove new connections and disconnect devices that were activated since the checkpoint was taken. + The configuration is now read from /run/NetworkManager/conf.d as well. This is useful for handing over configuration discovered on system startup to NetworkManager. + New connection.autoconnect_retries property that allows fine-tuning the autoconnect behavior. + Support for configuration and discovery of Web Proxy settings with PacRunner service. + Support for systemd-resolved local DNS forwarder backend. + Fix emission of NM-style PropertiesChanged signals and deprecate them for PropertiesChanged on "org.freedesktop.DBus.Properties" interface. + Change the meaning of unset "cloned-mac-address" settings from "permanent" to "preserve". This changes the default value and affects existing connections during upgrade that did not explicitly configure cloned-mac-address. This has the effect that externally configured MAC addresses are preserved by default instead of setting the permanent address (bgo#770611).- Update to version 1.4.4: + Order in which IP addresses are configured is now preserved so that primary address is selected correctly. + Don't deconfigure devices we can take over on shutdown. Makes it possible to restart without connection disruption for most device types. + Avoid reading the permanent MAC address before the device is initialized by UDEV. This avoids a race where NetworkManager might detect the MAC address of the wrong interface. + Fixed race condition when renaming interfaces, for example as done by UDEV for persistent interface naming. This could cause detecting a Wi-Fi interface as ethernet. + Fixed a race condition in libnm that could cause a client hang if a last value from a property of object array type disappeared. + Fixed a possible nmcli hang on D-Bus object fetch failure. + Other fixes and improvements.- Update to version 1.4.2: + Fixed emission of NM-style PropertiesChanged signals and deprecated them for PropertiesChanged on "org.freedesktop.DBus.Properties" interface. + Fixed race condition in the communication between NetworkManager and the DHCP helper which caused loss of events. + Added workaround for failures in changing MAC address with some wireless drivers. + Improved bash autocompletion. + Restored check on JSON syntax when built with Jansson support. + Fixed a regression in the serialization of empty "cloned-mac-address" property in libnm. + Other fixes and improvements. - Drop NetworkManager-fix-broadcom-wifi.patch: Fixed upstream.- Add even more commits to really fix bgo#770456 to NetworkManager-fix-broadcom-wifi.patch.- Add NetworkManager-fix-broadcom-wifi.patch: Broadcom driver does not support the random mac addr introduced. This patch works around the problem (bgo#770456). - Conditionally apply translations-update-upstream BuildRequires and macro for non-openSUSE only.- Update to version 1.4.0: + The MAC address assigned to a device can now be set according to different policies: preserve, permanent, random, stable. + NetworkManager now waits for IPv6 DAD to terminate before completing the activation. + Added support for setting IPv6 tokenized interface identifiers through the 'ipv6.token' connection property. + Added a 'Reload' D-Bus method to reload configuration and reapply DNS configuration. + Added ability to create a configuration checkpoints and rolling back changes after a timeout. + NetworkManager now follows symlinks when accessing resolv.conf and rc-manager is set to 'file'. + Added support for oFono as modem manager. + The devices now exposes counters of transferred data. + The 'may-fail' property of ipv4 and ipv6 settings is now respected more accurately. + The timeout for requests of secrets to agents has been increased from 25 to 120 seconds. + Name servers passed to dnsmasq now specify an egress interface to avoid problems with multiple active connections. + Reverse DNS entries for IPv6 are now added to dnsmasq, and IPv4 reverse entries now honor the network prefix. + A new 'dns-priority' property of ipv4 and ipv6 settings can be used to tweak the order of servers in resolv.conf when multiple connections are active. + configure script accepts --enable-{address,undefined}-sanitizer options to build NetworkManager with GCC sanitizers. + The default resolv.conf manager can now be specified at build time using the --with-config-dns-rc-manager-default configure option. + NetworkManager is now compiled with --gc-sections to reduce executable size. + Added a new 'VPN_PLUGIN' logging domain. + It is now possible to change the configuration currently applied on a device with 'nmcli device modify' and 'nmcli device reapply'. + nmcli invoked without parameters shows an overview of the current network configuration. + The 'nmcli connection add' syntax has been extended and is now possible to pass properties (e.g. 'ipv4.dns') along with aliases. + nmtui now returns to initial menu after a sub-form exits. + Improved bash autocompletion for nmcli. + Now devices are disconnected before the system suspends, executing dispatcher scripts. This allows external applications to be notified of the change in connectivity. + Dispatcher scripts are now called also when connectivity status changes. + Many other fixes and improvements. - Pass --with-config-dns-rc-manager-default=netconfig to configure: ensure to use netconfig, which is SUSE's default. - Replace pgkconfig(systemd) BuildRequires with pkgconfig(libsystemd), following upstream. - Rebase systemd-network-config.patch.- Update to version 1.2.2: + The dnsmasq DNS management mode now uses D-Bus API of dnsmasq to make signal nameserver changes. + Hostname is now correctly read on Slackware. + IPv6 addresses for default wired connections now stay stable. + Reading portname on s390 systems on 4.4 kernels and newer has been corrected. + nmcli no longer warns about version mismatches. + Improved developer documentations. + Multiple minor bugfixes. + Updated translations.- Update to version 1.2.0: + Bugs fixed: bgo#764750, bgo#764955, bgo#764956, bgo#765225, rh#1325752. - Changes from version 1.1.94 (1.2-rc2): + Bugs fixed: bgo#764839, bgo#764690, rh#1324895. - Add post/postun scritlets for libnm0.- Update to version 1.1.93 (1.2-rc1): + Bugs fixed: bgo#761389, bgo#763236, bgo#764317, bgo#764332, bgo#764398, bgo#764402, bgo#764483, bgo#764606, rh#1299103. + Updated translations. - Changes from version 1.1.92: + Added an option to enable the old-fashioned /etc/resolv.conf handling (using a symlink). + NetworkManager now checks the connection data from client for validity and gracefully handles unknown properties in client. This improves interoperability between the server and clients of different versions. + The activation of a VLAN device with a virtual parent that is inactive now results in a parent being activated first. + The server name used with 802.1x authentication can now be constrained to a particular domain suffix (CVE-2006-7246). - Drop (presumably) no longer needed patches: + nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff + nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff- Update to version 1.1.91: + Added support for detecting duplicate IPv4 addresses, with a timeout configurable through the ipv4.dad-timeout connection property. + Fixed a race condition that could potentially lead to unauthorized access to connection secrets (CVE-2016-0764). + dnsmasq configuration for shared connections can now be extended by placing custom files in /etc/NetworkManager/dnsmasq-shared.d/. + Generic devices are no longer assumed unless explicitly requested by user. + The reorder-header VLAN flag setting is now honored; to keep backwards compatibility in behavior, an existing REORDER_HDR=0 ifcfg-rh key is ignored; the flag must be disabled with VLAN_FLAGS=NO_REORDER_HDR. + Fair amount of bugs was fixed and robustness was generally improved. - Rebase systemd-network-config.patch.- Update to version 1.1.90: + Added an option to enable use of random MAC addresses for Wi-Fi access point scanning (defaults to disabled). Controlled with 'wifi.mac-address-randomization' property (MAC_ADDRESS_RANDOMIZATION key in ifcfg files). + Wi-Fi scanning now utilizes wpa_supplicant's AP list. + Added support for Wi-Fi powersave, configured with POWERSAVE key in ifcfg files. + Added support for creation of more types of software devices: tun & tap, maxvlan, vxlan and ip tunnels (ipip, gre, sit, isatap, vti, ip6ip6, ipip6, ip6gre and vti6). + The software devices (bond, bridge, vlan, team, ...) can now be stacked arbitrarily. The nmcli interface for creating master-slave relationships has been significantly improved by the use of 'master' argument to all link types. + RFC7217 stable privacy addressing is now used by default to protect from address-based host tracking. The IPv6 addressing mode is configured with IPV6_ADDR_GEN_MODE key in ifcfg files. + Improved route management code to avoid clashes between conflicting routes in multiple connections. + Refactored platform code resulting in more robust interface to platform, less overhead and reduced memory footprint. + Improved interoperability with other network management tools. The externally created software devices are not managed until they're activated. + The Device instances now exist for all software connections and the platform devices are now only created when the device is activated. This makes it possible for connections with device of same name not to clash unless they're activated concurrently. The links are now not unnecessarily present unless the connection is active, avoiding pollution of the link name space. + NetworkManager now correctly manages connectivity in namespace-based containers such as LXC and Docker. + Support for configuring ethernet Wake-On-Lan has been added. + Added LLDP listener functionality and related CLI client commands. Enabled via LLDP option in ifcfg files. + CLI secret agent has been extended with support for VPN secrets. + The command line client now utilizes colors for its output. + The command line client now sorts the devices and properties for better clarity. + Numerous impovement to Bash command completion for nmcli. + NetworkManager relies on less external libraries. The use of dbus-glib has been replaced with gio's native D-Bus support and libnl-route is no longer used. + Dependency on avahi-autoipd has been dropped. Native IPv4 link-local addressing configuration based on systemd network library is now used instead. + Hostname is now managed via systemd-hostnamed on systemd-based systems. + Management of resolv.conf management can be changed at runtime, private resolv.conf is always written in /run. + DNS options in resolv.conf are now honored. + Updated version of systemd network library used for internal DHCP and IPv4 link-local support. + Support for event logging via audit subsystem has been added. + Support for native logging via systemd-journald has been added taking advantage of its structured logging. + Live reconfiguration in IP configuration after changing the settings without reactivation of the device with "nmcli device reapply" command and via D-Bus API. + The API for VPN plugins now supports multiple simultaneous connections. Most popular VPN plugins have been updated to support this functionality. + The libnm library now provides API to access VPN service definitions. + Fair amount of bugs was fixed and robustness was generally improved. + New DHCP_FQDN key in ifcfg files to configure the full FQDN to be sent to the DHCP servers. + Added multicast_snooping option to BRIDGING_OPTS ifcfg key. - Pass --enable-gtk-doc to configure: needed to have the man pages built. - Remove --enable-ifcfg-suse configure parameter: the ifcfg-suse plugin has been deprecated. - Add perl(YAML) BuildRequires: dependency to build the documentation. - Rebased systemd-network-config.patch. - Drop NetworkManager-geoclue-interaction.patch: the patch has side effects when geoclue itself is not installed. - Drop NetworkManager-openvpn-route-configuration.patch: no longer required. - Drop nm-ppp-manager-clear-ppp_watch_id.patch and nm-update-ip_iface-only-if-IP-interface-exists.patch: fixed upstream. - No longer recommend avahi-autoipd: the functionality is no longer needed. - Flip with_cacert_patch off (set to 0): patch needs rebase.- Modify nm-probe-radius-server-cert.patch: Make sure the "Apply" button in Wifi configuration page of gnome-control-center is clickable (bsc#985332).- Move provides NetworkManager(cacert-patch) to libnm-util2, to ensure gnome-control-center doesn't hard requires NetworkManager.- Update to version 1.0.12 (FATE#318572) - drop nm-core-fix-crash-during-Wi-Fi-rescan-by-emitting-NM_DE.patch contained in version 0.9.9.1. - Rebase NetworkManager-geoclue-interaction.patch - Rebase nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff - Rebase nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff - Rebase systemd-network-config.patch - Rebase nm-probe-radius-server-cert.patch- nm-treat-not-saved-secrets-just-like-agent-owned-when-cl.diff rebased._ Update to version 1.0.12: + DHCP leases on software devices are now renewed when the computer is awoken from suspend. + Improved ifupdown plugin robustness and interoperability on Yocto and OpenEmbedded. + Fixed failed VPN activations when plugin supports interactive mode, but the VPN daemon does not. + Wi-Fi monitor interfaces are now ignored, not turned into managed mode. + AP and AdHoc mode connections with manual IP configuration are now able to autoconnect. + Broken device drivers (AWS ENI) that initially have invalid MAC addresses are now properly managed as soon as correct MAC address is set. + WWAN devices are unlocked a bit earlier so that supported IP versions can be queried. + The NetworkManager.service was ordered after network-pre.target and dbus.service. This ensures NetworkManager doesn't set up connectivity before firewall rules are in place and wouldn't exit before remote filesystems can be umounted ensuring orderly operation of systemd managed installations. + The netfilter rules used with shared IPv4 method are now removed on exit. + Ability to manage USB gadget drivers (UDC side) has beed added. + Infiniband transport mode change now takes place with the link set down because some drivers need that. + Race conditions that could disclose connection secrets to authenticated local users when changing ifcfg and keyfile connections have been fixed. This has security impact of low severity (CVE-2016-0764). + A handful of memory leak and crasher bugs of minor importance have been fixed. - Drop patches incorporated upstream: - NetworkManager-openvpn-route-configuration.patch. - nm-ppp-manager-clear-ppp_watch_id.patch. - nm-update-ip_iface-only-if-IP-interface-exists.patch. - Rebase systemd-network-config.patch for updated version.- nm-don-t-consider-not-needed-secrets-for-has_system_secr.diff rebased.- Split out a NetworkManager-branding-upstream subpackage that installs the default upstream version of the /etc/NetworkManager/NetworkManager.conf file. - Add Requires: NetworkManager-branding to main package.- Add nm-ppp-manager-clear-ppp_watch_id.patch and nm-update-ip_iface-only-if-IP-interface-exists.patch: Patches from upstream git cherrypicked to stable branch from master.- Add NetworkManager-openvpn-route-configuration.patch: Fix routes not being applied when connecting to openVPN.- Add explicit pkgconfig(libteam) BuildRequires: force team connection support.- Update to version 1.0.10: + Added support for handling VPN secrets to nmtui and nmcli agent. + Fixed a regression that caused NetworkManager to ignore external deletion of a device with master. + Fixed glitches with older versions of glib (prior to 2.36.0). + Fixed build with most recent versions of libsoup. + Fixed busy retry loop on non-transient errors from wpa_supplicant. + Improvements to testing infrastructure. + Updated translations.- Update to version 1.0.8: + MTU indicated by a VPN gateway is now properly applied. + Fixed MSS setting when MTU changes. + The default route is properly restored on device disconnect. + Build with older toolchains has been fixed. + The team devices can now properly be enslaved to bridges. + Failed DHCP attempts for assumed connections are now retried after a timeout. + Default wired connection is now created after udev registers the device. + Support for Bluetooth DUN devices with Bluez 5 has been fixed. + The ipv6.ignore-auto-dns property is now properly honored making it possible to override automatically obtained name servers. + Invalid permanent MAC adddresses as reported by some devices are now ignored. + Device links reported by more recent versions of Linux kernel that reside in different network namespaces are no longer confused with links in the namespace NetworkManager runs in. + MAC address changes of VLANs enslaved to a bond are now properly propagated to the master device. + Fixed error handling for teaming devices with invalid configuration. + Wi-Fi AP list is now updated correctly after AP mode has been used. + Management of a device is not attempted until the device has been registered with udev. + The error handling for VPN secret agents is now significantly more robust. + Detection of s390 CTC devices now works properly. + A GATEWAY property in /etc/sysconfig/network now no longer affects non-static connections. + Added support for IPv6-only VPN connections. + The systemd service now uses HUP signal to reload configuration. + Change VLAN default flags to set REORDER_HDR for new connections. + nmtui is now able to ignore automatically configured routes. + Numerous bash shell autocompletion fixes for nmcli. + Allow setting IPv6 and PPP settings for GSM and CDMA connections via nmcli. + Added support for adding ADSL connections in nmcli. + Numerous crash fixes. + Updated translations. - Rebase NetworkManager-geoclue-interaction.patch.- Update to version 1.0.6: + Improved capture portal detection. + Default route through WiFi connection is now preferred to Mobile Broadband if both are available. + Expose a flag to determine whether a particular connection is metered via API and client tools. + Add support for locking connections to a channel within a particular band. + Add support for configuring Wake-on-LAN capabilitites. + Allow overriding the MTU for team device. + Usual pile of bug fixes and robustness improvements. - Rebase NetworkManager-geoclue-interaction.patch .- Toggle with_cacert_patch to 1: the patch has been rebased.- Change nfs dispatcher-script to be more reliable in mixed ip v4 v6 environments.- Rebase nm-probe-radius-server-cert.patch for 1.0.4 (bsc#938198).- Add explicit pkgconfig(udev) BuildRequires: we need it to define %{_udevdir}.- Update to version 1.0.4: + The MTU setting from an IPv6 neighbor discovery Router Advertisements is now ignored if applying it would result in invalid configuration. + Some configuration options can now be changed without restarting the daemon. Notably, this applies to 'dns', 'connectivity' and 'ignore-carrier' settings. + The connection activation was made more robust. If an active connection is reactivated, the device it's active on takes precedence. If an attempt is made to activate a connection on a different device than it is active on, the activation proceeds removing the connection from the active device. + The device specifiers in configuration files now support negation via 'except:' match. + Devices that only have IPv6 link-local address are no longer assumed to be connected. + nmcli now provides hints and tab-completion for enumeration properties. + If the IPv6 interface tokens are set they are honored when creating an interface identifier for IPv6 addressing. + NetworkManager now maintains correct routing configuration when multiple interfaces are connected to the same network. + The management of devices can now be controlled with udev rules. The veth devices as well as the virtual Ethernet devices of various virtualization tools (VMWare, VirtualBox, Parallels Workstation) are now ignored by default. + The IPv6 privacy extensions are now enabled by default and handling of the ip6-privacy sysctl has been improved. + Activating a Bond, Bridge or Team device can now optionally activate the slave connections as well. The behavior is controlled with 'connection.autoconnect-slaves' property. + The platform support code has been refactored, resulting in better scalability in large configurations. + Changes to network interfaces configuration done outside NetworkManager are now picked up and exposed to the user via NetworkManager API and tools. + A connection can now optionally leave externally configured default route in place instead of overriding it. The behavior is controlled with 'ipv4.never-default' and 'ipv6.never-default' properties. + Multiple crasher and memory leak bugs in the daemon were fixed. + Multiple bugs that could cause the client tools to hang or crash were fixed. + nmcli allows multiple devices for 'nmcli device disconnect/delete'. + Firewall zone is added to firewalld for device-based VPN connections too. - Toggle with_cacert_patch to 0: the Radius CA patch neeeds to be reworked. Wrap applying the patch into a with_cacert_patch condition, to make enabling/disabling a one-stop change.- Update to version 1.0.2: + Wi-Fi devices now indicate support for 2GHz and 5GHz frequencies. + "nmcli device" output now indicates physical port ID + New config items added to the 'ifcfg-rh' plugin: - IPV4_ROUTE_METRIC and IPV6_ROUTE_METRIC. - DEVTIMEOUT. - IPADDR and PREFIX are now supported for specifying address ranges of shared IPv4 connections. + Dispatcher scripts now get a CONNECTION_FILENAME variable with the path to the configuration file for the connection. + An example dispatcher script that is able to apply complex routing rules (such as setting up policy-based routing) for 'ifcfg-rh' connections was added to examples/dispatcher/. + 'mode' key of Bond device options property now accepts numeric values. + Connection attempts for devices without carrier on startup now wait for carrier to appear within a short timeout instead of failing immediately. This makes system startup more robust. + Bridge connectivity is now properly restored on resume from suspend. + The D-Bus name is acquired earlier during the daemon startup. This makes it possible for the systemd service manager to optimize the service startup so that services that require networking are activated sooner contributing to faster system start up time. + A lot of memory leak problems were fixed, resulting in reduced memory usage. Many of them were discovered as a result of improvements in use of Valgrind in the testing infrastructure. + Management of 'teamd' daemon instances for Team devices is now more robust. + The 'dnsmasq' daemon respawns when it terminates and it is configured for management of DNS resolver configuration. + Hostnames that are not fully qualified are no longer sent to a DHCPv6 server for a dynamic DNS update. + Connection UUIDs are now checked for uniqueness when connection configurations are read. + Receipt of a NDP Router Advertisement can no longer lower the IPv6 hop limit (CVE-2015-2924). + Many other bugs were fixed. + Updated translations.- Add NetworkManager(cacert-patch) provides: to be toggled to 0 whenever we disable nm-probe-radius-server-cert.patch. Other packages that consume the ABI introduced by this patch can specify this as a requirement.- Reabse nm-probe-radius-server-cert.patch- Add rp-pppoe BuildRequires, so configure can autodetect the path to the pppoe binary. - Recommend rp-pppoe: the program is needed for NetworkManager to be able to initiate PPPoE connections (commonly used by ADSL providers). It is not strictly required to operate NM in most setups, thus only recommended (boo#903553).- Update to version 1.0: + A new 'libnm' GObject-based client library to replace libnm-util/libnm-glib: - IP address, IP route, hardware address, and other properties are now represented as strings. - Based on GIO's GDBus bindings instead of dbus-glib. - Uses modern GObject APIs including GAsyncResult and GVariant. - See https://wiki.gnome.org/Projects/NetworkManager/libnm. + Devices and VPN connections now have individual default routes. Priorities are handled through configurable route metrics. + nmcli now supports password requests and PolicyKit authorizations. + A faster, lighter-weight (though less capable) internal DHCP client has been added and may be selected with the "dhcp=internal" option. It supports fewer DHCP options and does not yet support DHCPv6. + A new 'configure-and-quit=yes' option has been added for environments with less dynamic network configuration. + When running on 3.17 and later kernels, NetworkManager handles IPv6LL address assignment to ensure that IPv6 connectivity is not enabled until intentionally configured by the user. + NetworkManager no longer causes the nl80211 kernel module to be loaded on systems with no Wi-Fi devices. + Bluetooth DUN support now works with Bluez 5.x. + VPN connections can now persist across link changes and suspend/resume if their VPN plugin supports this feature. + A new 'ibft' settings plugin has been added to support firmware-based iBFT/iSCSI configurations. This functionality has been moved to 'ibft' from the 'ifcfg-rh' plugin. + IPv6 router advertisement MTUs are now respected. + NetworkManager no longer requires polkit libraries at runtime when Polkit support is enabled, and Polkit can be disabled at build time too. + Automatically created connections are now deleted when their device goes away. + 'nmcli dev connect' now attemts to create a connection if none exists. + Manually configured static IPv6 configuration is kept even if SLAAC fails. + Manpages for the 'keyfile' and 'ifcfg-rh' plugins now describe their configuration syntax and available options. + WWAN connections now support IPv6 if the modem and provider support IPv6. + Software devices (bridge, bond, team, etc) can now be deleted from the D-Bus API or with nmcli. + The manpages, documentation, and API annotations have received many cleanups. + Externally created virtual interfaces are no longer managed by NetworkManager until they are set "up" or activated via nmcli. - Disable nm-probe-radius-server-cert.patch for now: needs rebase. - Drop 0001-core-don-t-auto-launch-logind-bgo-741572.patch and NetworkManager-dhcpv6.patch: fixed upstream. - Split out new subpackage typelib-1_0-NM-1_0 and libnm0. - Require typelib-1_0-NM-1_0 and libnm0 by the -devel package. - Add pkgconfig(bluez) BuildRequires. - Replace pkgconfig(libsystemd-login) BuildRequires with pkgconfig(libsystemd) and pkgconfig(polkit-gobject-1) with pkgconfig(polkit-agent-1), following upstream.- Update to version 0.9.10.1: + Kernel 'cache' routes (such as those added by IPv6 operations) are ignored, preventing unwanted CPU usage. + Vala bindings for libnm-glib async methods have been added. + Some interactions with external OpenVPN daemon default routes have been fixed. + Fixed usage of libnm-glib connectivity checking from garbage-collected languages. + An unusual delay acquiring a DHCP lease with dhcpcd has been fixed. + A libnm-glib crash has been fixed when multiple NMClients are created. + A failure to pass certificate blobs to wpa_supplicant has been fixed. + A failure to send the inner private key password to wpa_supplicant has been fixed. + nmcli now returns earlier when activating master interfaces. + nmtui password fields now correctly display the password. + The IPv6 hop limit is no longer mistakenly set to 0 in some cases. + Some DHCPv6 failures are no longer fatal. + Handling of DHCP 'nak' and 'expire' states has been fixed in some cases. + WiFi band locking has been fixed. + Support for Bluetooth DUN with Bluez5 has returned. + Non-local users can now control networking after authenticating with PolicyKit. + Externally added routes no longer have their metrics overwritten. + Some child interfaces (eg VPN or WWAN) are no longer deconfigured when recognized. + Support for the PrimaryConnection D-Bus property has been backported. + IPv6 RDNSS/DNSSL forced expiration is now handled properly. + An invalid route to the DHCP server is no longer added in some configurations. + A crash when external master/slave changes were made has been fixed. + Various nmtui bugs for slaves, WiFi, and IP address buttons have been fixed. + DHCP no longer fails due to SIGPIPE when the systemd journal is restarted. + Unmanaged slaves are now updated correctly when they disappear. + Cooperation with external team interfaces has been fixed. + Bridge STP property ranges are now properly checked. + Manager state is now properly updated on resume. + Slave interfaces are no longer released on exit. + Static IPv6 configuration is now added before SLAAC is started. + Allow shared connections to be started without a carrier. + A crash when disconnecting older Nokia phones has been fixed. - Drop patches incorporated upstream: + 0001-core-don-t-auto-launch-logind-bgo-741572.patch. + NetworkManager-dhcpv6.patch.- Add NetworkManager-dhcpv6.patch: dhcp: let dhclient handle requesting the 'server-id' option (boo#912315).- Add 0001-core-don-t-auto-launch-logind-bgo-741572.patch: do not trigger logind start on system startup to avoid deadlock (boo#905639).- Handle NetworkManager-dispatcher.service using the systemd macros. - Enable NetworkManager-dispatcher.service in %post: as this is a dbus service, the 'systemd unit' must be enabled in order to be fired up./bin/sh/bin/sh/bin/sh/bin/shdhcdbdlibnm-glib-vpn1libnm-glib4libnm-util2ibs-centriq-5 1652785674  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmmmmqrsquvwxyz{1.22.10-150200.3.18.11.22.10-150200.3.18.11.22.10-150200.3.18.11.141.14 NetworkManagerVPNdispatcher.dnfssystem-connectionsnm-dispatcher.conforg.freedesktop.NetworkManager.confnm-onlinenmclinmtuinmtui-connectnmtui-editnmtui-hostnameNetworkManagerdispatcher.d90-nm-cloud-setup.shno-wait.d90-nm-cloud-setup.shnm-cloud-setupnm-dhcp-helpernm-dispatchernm-iface-helpernm-initrd-generatorNetworkManager-dispatcher.serviceNetworkManager-wait-online.serviceNetworkManager.serviceNetworkManager.service.dNetworkManager-ovs.confnm-cloud-setup.servicenm-cloud-setup.timer84-nm-drivers.rules85-nm-unmanaged.rules90-nm-thunderbolt.rulesNetworkManager1.22.10libnm-device-plugin-adsl.solibnm-device-plugin-bluetooth.solibnm-device-plugin-ovs.solibnm-device-plugin-team.solibnm-device-plugin-wifi.solibnm-device-plugin-wwan.solibnm-ppp-plugin.solibnm-wwan.so2.4.7nm-pppd-plugin.soNetworkManagernmcliorg.freedesktop.NetworkManager.AccessPoint.xmlorg.freedesktop.NetworkManager.AgentManager.xmlorg.freedesktop.NetworkManager.Checkpoint.xmlorg.freedesktop.NetworkManager.Connection.Active.xmlorg.freedesktop.NetworkManager.DHCP4Config.xmlorg.freedesktop.NetworkManager.DHCP6Config.xmlorg.freedesktop.NetworkManager.Device.Adsl.xmlorg.freedesktop.NetworkManager.Device.Bluetooth.xmlorg.freedesktop.NetworkManager.Device.Bond.xmlorg.freedesktop.NetworkManager.Device.Bridge.xmlorg.freedesktop.NetworkManager.Device.Dummy.xmlorg.freedesktop.NetworkManager.Device.Generic.xmlorg.freedesktop.NetworkManager.Device.IPTunnel.xmlorg.freedesktop.NetworkManager.Device.Infiniband.xmlorg.freedesktop.NetworkManager.Device.Lowpan.xmlorg.freedesktop.NetworkManager.Device.Macsec.xmlorg.freedesktop.NetworkManager.Device.Macvlan.xmlorg.freedesktop.NetworkManager.Device.Modem.xmlorg.freedesktop.NetworkManager.Device.OlpcMesh.xmlorg.freedesktop.NetworkManager.Device.OvsBridge.xmlorg.freedesktop.NetworkManager.Device.OvsInterface.xmlorg.freedesktop.NetworkManager.Device.OvsPort.xmlorg.freedesktop.NetworkManager.Device.Ppp.xmlorg.freedesktop.NetworkManager.Device.Statistics.xmlorg.freedesktop.NetworkManager.Device.Team.xmlorg.freedesktop.NetworkManager.Device.Tun.xmlorg.freedesktop.NetworkManager.Device.Veth.xmlorg.freedesktop.NetworkManager.Device.Vlan.xmlorg.freedesktop.NetworkManager.Device.Vxlan.xmlorg.freedesktop.NetworkManager.Device.WiMax.xmlorg.freedesktop.NetworkManager.Device.WifiP2P.xmlorg.freedesktop.NetworkManager.Device.WireGuard.xmlorg.freedesktop.NetworkManager.Device.Wired.xmlorg.freedesktop.NetworkManager.Device.Wireless.xmlorg.freedesktop.NetworkManager.Device.Wpan.xmlorg.freedesktop.NetworkManager.Device.xmlorg.freedesktop.NetworkManager.DnsManager.xmlorg.freedesktop.NetworkManager.IP4Config.xmlorg.freedesktop.NetworkManager.IP6Config.xmlorg.freedesktop.NetworkManager.PPP.xmlorg.freedesktop.NetworkManager.SecretAgent.xmlorg.freedesktop.NetworkManager.Settings.Connection.xmlorg.freedesktop.NetworkManager.Settings.xmlorg.freedesktop.NetworkManager.VPN.Connection.xmlorg.freedesktop.NetworkManager.VPN.Plugin.xmlorg.freedesktop.NetworkManager.WiMax.Nsp.xmlorg.freedesktop.NetworkManager.WifiP2PPeer.xmlorg.freedesktop.NetworkManager.xmlorg.freedesktop.nm_dispatcher.serviceNetworkManagerAUTHORSCONTRIBUTINGChangeLogNEWSREADMETODOserver.confNetworkManagerCOPYINGnm-online.1.gznmcli.1.gznmtui-connect.1.gznmtui-edit.1.gznmtui-hostname.1.gznmtui.1.gzNetworkManager.conf.5.gznm-settings-keyfile.5.gznm-settings.5.gznm-system-settings.conf.5.gznm-openvswitch.7.gznmcli-examples.7.gzNetworkManager.8.gznm-initrd-generator.8.gzorg.freedesktop.NetworkManager.policyNetworkManagerNetworkManager/etc//etc/NetworkManager//etc/NetworkManager/dispatcher.d//etc/dbus-1/system.d//usr/bin//usr/lib//usr/lib/NetworkManager//usr/lib/NetworkManager/dispatcher.d//usr/lib/NetworkManager/dispatcher.d/no-wait.d//usr/lib/systemd/system//usr/lib/systemd/system/NetworkManager.service.d//usr/lib/udev/rules.d//usr/lib64//usr/lib64/NetworkManager//usr/lib64/NetworkManager/1.22.10//usr/lib64/pppd//usr/lib64/pppd/2.4.7//usr/sbin//usr/share/bash-completion/completions//usr/share/dbus-1/interfaces//usr/share/dbus-1/system-services//usr/share/doc/packages//usr/share/doc/packages/NetworkManager//usr/share/licenses//usr/share/licenses/NetworkManager//usr/share/man/man1//usr/share/man/man5//usr/share/man/man7//usr/share/man/man8//usr/share/polkit-1/actions//var/lib//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:24287/SUSE_SLE-15-SP2_Update/ce9282e4a2092de3608cb160f98a2d74-NetworkManager.SUSE_SLE-15-SP2_Updatedrpmxz5aarch64-suse-linux   directoryBourne-Again shell script, ASCII text executableexported SGML document, ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=bac818127debd429db7a0484f34458dd2f60161c, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=47a864e7f6335b51ee761d417d8d62b69cb26c62, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=fb3ce79748cb8a62117cb8048fecdd129113d372, for GNU/Linux 3.7.0, strippedPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=a03f517d1bfc1f4f4791486bcab501df4e081b42, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=3c36d1d32c2daa1cd818395df8146a62e4602e78, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=c7d078aff53cf1cfa0f2495147bea8b0a3822bf4, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=98b2dd25b36edcc2bd91861f630c1f93bacb7480, for GNU/Linux 3.7.0, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=e90e82984d009ad352d8d658b3a341cde9c50e30, for GNU/Linux 3.7.0, strippedASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=99a9cd49a32ceb3fe54dfd946755fd5c3e6e99c2, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ca91d55e1197e82ea4542a5d50db77c5c94ce002, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f9fc95c9a7cca02c86762411184c0ea82e09653c, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3b433c7490bd45c19284032a8114efebba2d913d, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=02155433d3873b668d07bd076511bc6244ab0d42, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=50dc961ada735dd26283f679532de005e5423ea4, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2752d90d6a3f89ee42bebb08b7bd05dc583e95d1, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c99f3da0d8f476217fded8fda0c497caf11592c5, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d016c3e2eff774dd90d95376e78926765ad662ab, strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=aa9a47756950039bdf3292fcd12d77dcaefa3dc6, for GNU/Linux 3.7.0, strippedXML 1.0 document, ASCII textXML 1.0 document, ASCII text, with very long linestroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)Algol 68 source, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix)XML 1.0 document, UTF-8 Unicode textempty &CDV^i   RR#R RR"RRRR6RR R R7R-R+R%R$R/R*R'R,R)R&R.R#R(RRR"R8R3R4RRRR6RR R R7RRR*R+R&R-R(R%R$R/R'R,R)R.R#R RRRR"RRRRR6RR RR R7R,R$R/R#R+R)RRR"RRRRR6RR R RRRRR6RR R7R R#RR"RRRR6RR R RDR7R>R?RBRRRR=RCR:R1R0RRRRARRR6RR RR7R RRDR2RRR=RCR:R1R0RARRRRR6RR PR RRBRARR PR R7RR R!RRRR6RR PR RRRRRR6RR PR RR@RRRRR6RR PR7R RRRRR6RR P R RR!RRR6RR P R R7RRRRR6RR P R>R7RR R=RRRRR6RR R RRRRRRR6RR RDR2RR RRBR7RRRRCR:R1R0RAR=RR9R5RRRRRRR6RR T,Ѻ^ &'*dnsmasqiptablesorg.freedesktop.ModemManagerrp-pppoeutf-81692a1c8a1cea4fc615034a8a321fbd557f696a9c1efff61ac1d8f9ac13c4c46?@7zXZ !t/<]"k%'9h]ss%_tĜJ"GsÃ.WX |;)>?8kM┳ \*ȁ/Dp<5^kqnd<}c.%zO'*(0 VJu X刞E "J3 |HcO|Ѡ0V{xr9XX^tz娔S&n&TEJ _%|h 1%rxʧLV{W~4ܮ_{`h"?~B+nP/)ȇ/v|"4b8I rf] [(f<P}"lHX\"uH䱆 g2:IJ_V8FŒ?@=V4wtc-['7SW!*.Q=1謜 8kh۲dL~&9Q8(˂ *. dkrQ}?enuR*5 [WUe/kQ5b/|^1BK$̃"?nyk;g!̓WO$PȥC~Erc;SEf2SMUmDrѕ[}R=_0mu(4I1)cMп:F@C<(X;:5@2`iU@1-:+!Cw %)^9}m*B濶z 0?lDM'Z"oBהCʅњn8/:#yq(Av8K3.2ByWi=0^Xɇ AD3K0\'eMXgq+C>Hāu ̭wٹ>W;vƳV`Pr)^yl.ܜN撲u$nPEZEuP28>xT3/IpP~چqnqV`X+Do.$7R.{i$HR<B*(S{%q7 M,ct7(AD& 8)p7Vڌ|"-EH6Jny"`.p F ?tjKjiqrJUFе&k5V$zF" ʼ=Z .9 etR¡/`nƆ==> +@%?7:)1^&Eӵt8%:3E5v]}p-&*!8I8 =}M6if8"Lw n` E63qI$/̌yHG=$(/ b?y@WݏZ)Aǽ @5O|XZ8,(C #u_16̙xa+&,K /h=U\cA.>Ӏ@<ۤ򌬰 =c(q" 5w z&JևjQ4 WRXb3[P_Uj1%HM |Q'P5  Qq~a&B摒+|a5gL qt!ɇ` cᨃƍVܨiF,D-q͍ya9/[fU{uqvy^ڝDCq\$ZzUJm $}q_/Qq kІumKHorLGzJ=>&2ifMI`ekԛIKT5Ϫ ΰ"Z  <\ZBnk <}ӒANݸo9`>8E8&f׹bWEL2ɡ>ٙvqO lfdlwUs<:f\   F:Xvp܅ LץX|͕ Ǹ͍.^R.,Ȝ _WGݔQ#ή[+{k[[rnp hQPm L^&10RɝLD79`nVǤU>Ib`ճqG6?cx|? ,ZͰjvKBҐcVJ)5c_3ӌ3!*DKs9ٛZd:DGhQnUe'#6G@d g;A}~4 xATd)%exK,V4F⊀㲬+JԦxRUOM YG!)ms%gF~}^z!4ޔ_/ ؊|&uǢ$&^[n$;%vAo~x%ۖQ5ƨ+~2Z RZ *HUM}87j̨jAI(4p+%pL?8CXů#(-<:$ [W͆N&?I&yWtCNhPX%'=u;}g o;fiưikC]Tk ՙ|1?" D9XP_>7_BJXA)=&XJ¦;nquca e.of?xa4c- ut JC~(&jE<e:SVHn,"^ȅ$U m^Ȫ%2ID(s۪Jˋl/CS":;JĔ#te!FvOSnnhg> KeM9LvI5~ 1;iRk9W;VJ9ǭ\kùO 24P[b^|%w uQJ̓Qʊ^>UmMKĞ8:h8-y TQ9aH^qرT &^yI%8ѹ$%rdT)Ō^QӁKiܿu[*酚}83l/ ;ZS8L'\y+Hj{jt%ҕuGCEi ਞ̗ d&ٸbXpB㎄mQ@sʫI^:swW[ Cza@,NM؅q[DQ#XzFɒȝ:& 6C2e*/>y1Gv҅F=.)n? <=U o'01n,oVn^hYc@+ \Օ˯Ǵޡiëfnvj|K*1sKq +ʥ~uR_n[׋s!4re@GmF6y?[.L^p~F$++XwH4) >R1C$Ylf6)xג-8+Epm"J[fw5eݷoլkN슇1L<%4Cj IxIdarZm]cRtjZvV:O)fas~-#}iԑYxʑQOXBuV7"\z"sa)a]2ZŊ|(H,y-)j}őB*-rVdaP"_Cë{>Z= H8V4\0 F;e@lO,c-f *OV]\ PgKLyoKrׁ]1m:FJũ9;}={bZh\7BU9&DkЋ8cBJܑcʒ1_Bz[ڵw2\sIn{hEE냚<P'E*G^2DNx]܀& (VW#V#ʕk9emom: 9J,b*zMt}Kx}j!-*|U5ccJ7v] `/䌽1ӕ)QSm(Tjd<-'s3;9NW:ywl/\ӺDIE Jn\5Ɯwy3؁2>º[&Wo"5RGl{EݗqObQH/`p?׉+tE}sX?y<'w=7#kqa.#Y22O,4R}b-XUpڢc+VUMLL3_}$#A6Ý+Qv]*L3w''i3ݣ6gzYoYY̷p旿);M߮M G0Q UeKnAi%%9?0X^xb OE)j& uѭN󢊁NlbcHGA\ UkTG1J|֢ȶd9ZO`$~ݛ$|z"eD FσvMJdTˉ߭I3d8#|S0VHuAo9ۤ.@ۇSjZt^ >tMē_{mUZ X^P{x&#aHGκ]h~hd>R4W@;2Q)LAҏg_[tq{AZv7;U`ah|D6':*.WHCqY0KO CXZO*rL~A),U+6MSZ;ALeZ8Mmxr$20귷Dw/cE\D{ic#fDZ7% Ra #]*̢Tس#q:"ymkrN_*ի_tj< XV&!!`=&$XW3"@ qpz~xmGā8kHh#yɳ7Ug\A;"nGYQ. FIs3+/o\l}[oEU-b7c6Þ+Ih_EYsU|o t0)4x\ n_TȋZE1!-]?.Ϩ/X nM!r9WVё͍݊zX={BODMsJ7Zh9:b:@b!;oЏgC#_덓{ K} (OBZqf[,j{+JMN}^/[1n]4EcYbmGH9WaX1 O);r/:~#a0@.#q50Eri͟2O{]1 Or17g3}X [Mf*CyM\ԆRՈcmOOJ'Zc 2QEj4n|&2y7 |U,+P- &4tV"$p<.LZF;oF]k.'B 'h-5[?}@qSFCbN=tOr s_Rk, 5dkXnަ/:Rpi[ysc ֌2x"Kr-6HTJ.t(QBTiwyiɫPV"]O, OQ67Ox8SWgD-ї3_Έ0W|̀n^W΃/ q$[Xynnx>Th%;$p$,ۚCs@{hԧmCǙBךJR$<^_hFvod)tL$nDKޱfChݑnsjN4JqlqvT>uNH"jZ h俴 J6م/@:븓bX;kBT"}tgw2a4oRA"mk~JlזhoMui/pz% \!}Ego~[z^I$发} M?#E22R{ʞ9ZT6-Y5?f_n6BnVX&P%n˺!%k?7VD3\۝?%S b8W]y^k`Im(H@B?>Vh#*D%s E6P9Aw?Kt3W[1ᬺa jQ1Ċ Gkax[ pW w>Ԇ3IKVxRA}=.Q'b&#oˊ4b a"\c6mH=PԤx5y=փmQ_;v0ө| 譒^R{#LJw4Fƫ?I%?YJ;g 2D`EjVPuQܣ0esgѶ S4)H?0U2$E 2 iLJAB TTeo:"-ll6Ppߖ,b̒Q*RjIV^ _ZTj|R9 fzA Jm^lkQ@òCEH-[j=GQMjt0kUi۬Z<,F^7Znd$4̸)Ȓ+b \̷/VPэ] c_,p 3oj8{rȍHϛS6"ȨLC#0Džy[JI|]V &KW땑OE8BM u}:?G+>+ɅVt:{U S4|SapY ş5I꺭S&Q M"зG)) YQ|𒿉mLk)8 e8@]L(Z $,ee<ɯT~J#Z=(>:kÉm"nϯUʠ%{jz~ɵ`()ϚoJRoJ ;vKkx5Zf;YZχ ˘y^[W }A|p@~6$8k`k69$VKc#aJdܠ dZfJYa JI._{3Sz^9Y[_C4ǭ׾7bk:%!;%e&dY,Y~ F+~")I{upP(w)"ڢ~< -](g9%5v9߫/ \ZPJ5,\ dU]Kl ټ"⯔Y-m p:@a'f/^GʱGc408H، r7Ugƴ|-O`U\Fdenvӻos_ߋZXCZV\4/QbHh0B#YPbhP+_@ofcƥB!=FpPxk5ːo;hD~vq:=TV#K2s{qRm<9ߠ)Sg\1@rK`e;l zFrY:2tI%n9g7A"jt=ʓMX0’w Yw̐)TBQ3 Hlq<88' 8_e>]gJ;]HJ-%\cm{Z"th !\F W"T\.){^vN݉ZF^y31Ђ2j5,/Nd5bBXSFj vcn],n fѬLOΏ!d Ue{a)fjl;6,T&ַC˞`'g+Di 2x 08Դ'2?DiBD3"ECB1yZƣ4ƙ++SRvBR˛4O#.lߚ2Gf|[!ĵh0^DsSƌFJ(jaf=NA0#xC__mbMYVfA X~[[ ^oFh轜,& V%L vហ!'](0e-X]Ջ6n [ՐV̼=t 'aR% jY~4ɜ^Ȁ4jRKs8V`=öˡMFEp`|0ѿo}a=,=ΛwŒx{Z)$G_Zi;I5C Xl~3||]V@ф4@EK-D m{ې(K@0&@i_!-> ~yDuB6֖TPW;&mSYHy۴Lo.lnK{8krkBZFC%)#Pvv9 ڇtbkQwpK;(S $q+ݣ4@Y9{ UHQ?[^zu4[:ƞr8Bxr T=#Uw vTV>bj&k`Ƽ $%owq3*@zNq!u׊4.c)9ɺyęn܁x8t4SuF2[ꧪ3Bon`sDvgT*fl twmY/2G䰳(ca&1ɴ|# Bʮބe13~čT|gm3l SQ!hW顣k.& ajx Κvgt ]!_g{N [~MP&'/'̀I!E*06˻]-HW\~:P0=xc5Fڠ{)x-QGXǷi51tp:ma?l‰huN !֋_4xmKVQf"1DdmnSMj-ò,'iP~xQoT$f=`!@gq:^g >e[*BS{ Ɏ=W3m8g1/8-Ğ(şf&2KB SEr埾 "HkʔgJt2 y>8j[ х{k2 MQH!"ޔ y9L. E{S\ԑ\"w2C 2s*rNFG̏Hh|, ‘ZKI OÌ7oT?YZS.Yf\NʲsᆤJ:MO &iw|5 BX,ѶM{a+Qn6WkN'CCdWfX̺6|a܄Sa֊ [$WT"?mwrv`0-%#`l|NPCWH)UP~,vgRLmg~iqv/3b x%,s9Z+j5k YCrʦDQ~2,`Bc=&+h8&!@_lƱ~3bmM]R>kڐ8ӻθ4| W ڐrdͬ_QokǶݟ6plMqig(Y^y*@0,NBqUJ13t񶲐R izZO}#Ÿb짩!1?c1Dң*hQ8I|*aMҺʋ_IAb/A9%Tnm@>EdXw &Kc_~n'Ȝh:a<&|asNŤT3: -LV XN%9jxշJO#KP^W:[_o Λɚ-*0BZZ?#Z3}vd#zÐL2,P0-~&_md`5$y-#;J:I냷1\PᔌZ I;dk< }>x'4~|oWͯs9Qwɟ{8txWS¡j>nKm<D[huB-*9_vU(ҭf.ur KMfy8JQk2O7؈r`,S֢#AXQFYO?$y?*` WƗ 3c:dF+̈J"%buu(Z:H۝^&A5\@U)i^4Ga3}b{Ћ-glwxCzAbXQN@44ÿH} `#k|'TY>ôml]Xt0(HaPH~- 7Ɍ{W{-@u]vJ~-̐a4@h1A 0CYDo\Eb:ğZ*?nojg)hHp5߲Wg([U7@ۓP#pKmŒZl5N.Q93K]1-us7π}s|0'$![w/,-xW,0Te*q"4a>IE]Ziqҝl$U? R6\TS4j^aYGZ*v)Fd jAcX]#  %Fcth؜Sg a-mL)%x؟"rzER_8uҗ-o2 SUc 6;*5TƶEݻ"9e*f-msZmĎ hA";uMI1Eӏv10(ӭt|^HP$y&B>麘 @>u%djEeb"Q|q;to'ZQyZvaFe(_RpH7E ^֙Hv0TMKuЮ b^8?&pO]l@Y~kHD+&)RT'8Um( ?pP 9 9@Tv[SYoK:ZUWT/0(dE&*v8ƇLn 1w4mzui,$]`1.}mVF%8J>=6d;:r̟2IC J?=NhjC _SW[~72x׻1a .(wjHP1ӀK^c%\7 ]7SޯB'4PnCfsd9HΡ5#~B<|I!SC1 n¸ *; s0z Ihz*`N}UɼM>5vߟza_tRXil| N0'p p_KʼnC$#x$MTL +:# jH3w0M;Y(ZJ aQ$ʩDL)5>QLMC^to9WQW4re녖-C{;%orڈm|)_tJ>}aoa\N`Df"]E@ Z}C @gyGGzSN,N!ɽ@'f|⠪_^pƲ.ݨn٬f|frv؟~yJlm. ~B#hng0;T'A@P}fI՞\H$$J{-kQ!U2(ƛ\F&V(zۚH8_8—2TZV!Xk\[iDp)i-KwY<L$>u\C6Q$Q6ϛbMCĘ(=Q`T\fZ6*xAzomN s6&Oj^ۜ<22ͦ;v )-~U_@Z>mG2J͙1b *͜q&Jg)TAdnEB_e1}t7BReQE]jV{enL6Ŋ?\[Le6FDp]ݬA r;'Xh0,5۷Nvwe(Ls7@V\`MV 7OӝƔf'Y2s[# (/0m4? rBKQ`<*#]׋cw6K>,GvY8==}W)L>ʴ @!DiG\W'?J9_p/պCCeU}fS};c%5+<1 MLlDY"vj&7}7!vú x!A㈶@ÂIdfی~Y}F l-&) qG$ڣw^VdjZo|9ڭ[,K;{)U-P̔'qUsЕ2PWuP{7O YA!A%΁nd-杔cq`  w" YKGӯR\" 7Xg҈L7Ql wy-,N;=΍mĘ<o7

H)(xwB_vXZӟ'OYYsA%V*whK1:A2jGi{nGQ&*>%-d'ʪLJO֙T4]?MQاsO%G ƽr7+zѧX%/nHZO%aaJysHh=ldC3^rS>3~F!WvK+9)^éb)Qoz֥[L |˂ 7Û=js:@0|=1=AwHqfw@ (;?=e>}@L-7As8`1q2_TҙcB~ K9;enDkՌB?r_bH>+%)0Z)몮,Upbak"eGb:c H&z!1 \3E5cPWs-e*UpdW L SN5턁"SX2IMċ qF)O Qn`5j֧~0SviOq~&E˖}D@ }4pҗ +i|kԥSd H(^D:(๩ 0PKJ( ΢`KtMV|L 6Ȁ!XSBvP:)kӗn[8R|gl/&=̘v3zq^gR=jS3d싽^fL'gvty5T"I+g҄6Xr1 BYO0,כE{E7~nZ:-^Zt:S%>+sV'yo)צ} M|RP%0a&T=gYW0M3Wճ@v4rq Rqg0ՎF_x0vLv0dN|mIfay/i kLj X5i!bXCH-ely)ЮE>R9;x]m>8! PZ:ZD,)6@^t2`%>2gFEgޭXAoϹl{ݣG:elA?C|ߨktZ$FSU_ ҦOnQb۫P$#@jE!&Ql&לJ e;j&DϟeM~[.Qm]2e\Ӽ߄gF?i$/<9Aϙ1_/ulV}|5(+8>UI׸;R^JyVX /IN>9rP۵D C-,zd4;{fsr!=~'޿mr6Ԙ؁.M%!dLX >'vh^12>EURBZ&DZje{'5kY笗1~H+г;2tYCf3|4y QnT B]nh1$gg7w +=ºqmscK2}Oâ^*ch_?(,AaZSUir(b=NW,,lZ|s6W76cTjw{t֌VXr97Y:X%g,2rTsrš7T5 c\S4 ,g[Xyaz`؇*<>^mU:5wJ&㣛nXwǔEf#xP' Y>iVr,0!4-#jGnR?;-0=/N>Myx֭d blc #"&4x0ͬ,XیiCxF޺Ɔx22n6dvSb1BS3 XGR(Ύz$x)rGcRܯ$ƟT/䇋Zml0%e>¨!!"-6~hA7e Ai(] "^n'%\Nѵv!2wֺ'6eۄs^;O-|:Kn%GByx+ezh $k3kg;9Vg2Zɱ5"t ؚr>d.'?\(ݠ_NѽOqj' s&16jY?8 &>*[@WRnధEw!uu\-e)oRwao0J A9&iNn"Exl (MbYLC;[ocWGkΝ/*$"jX¾'Iqвb&XTM{y"Z@h0\58moc>KN5hixI ҍ9Y?K.q<*س|?«ϚD"\%3م4Vs.BpTu66]Jlm{ok#PB5޺nie_`*m\'a 2v{b̯p슰nӟI+1^j(M /z[bjCh830!vO?r`!tA9&*SWM3j)Tx̖  S':ٗo׍Q!uF`JQ*$28 c8ձ'_ЁfdF65ghes6`R.OF!zwԧ*&(,oٕʅ >M'еzt?kZ6Shg,C 1j]BJlc;"-D(ä#\U>Sx!PNoK'_@gERkԎMT˺`cYs0*lUhx$\BU !b7I84^qgb]㢏` [HHԪ60 'i%' ;HctF2v ap1k/kqKѮY6kGBW':fo^&S8 @iAKe1 pƞjX| iD@)9=_N21 24{ l%́[ 0 HMm]'fj} &T7U)ӆGT֏XS9UqC}F6 UxȠr>w!>kc5eYЛu:w)veՁ So&i~(8/ǀim){3;n򚎈 zՍNm~2v!F:h|zH!y/K9P/9*N| :F6Dv{@w #3 {F '&R:;f~y.][8o/K  ɭK5x :|:H+.k=!>HV.(Z0St~jpA nśzx}+D?pd>`?ShuBэLz)T ]⸋s%h_-!ꨥЧꓖdu_P[0r$vRC47"ū> ͞N6`8VLgɯN]"8͐\( 57*KX4Xoi;*0:ģ)X'C"$MYdߘkb.l ;;R@Cg 7M-#"u1Mo T]?l ?E#_Ү)q NERL_zyǐio " B us=Dwv*HIiƏ%KIR͖ 9Tp`[Smb?rPޣVoGr(k =)fˆbO,E%}>Wqs.É>弶mY^ڲ<6Ob5E6RbaPV^Y?kJn}d}2~iEk i~h \x&5FHuXMVjїS IH4￟)}I$\6HG;=*w*ꢐsHy[m׾%F,K7>~gki9 Z8$h/ Nǎ4op]H 1}VJfpM|!6ߎ& 9%d 9d=߉@rF.UޔVDtD'ȬRi\$H:'ԔQeh'VhPoU)MM"7+~$K)F [v:bcIBҸ|_]h@F s6J™"E*ϱ}v$1/al!kȝ ᛣ>i*#mNMF{+LduA,apq s]ߘ\c&NVkmKp8#E;#x,PfX~E8i6=vHuTu[<<%(c';]UNIHmNQw+5T @wc^zhTYYT9֤ `P9L Hkm}S LmJ$@#ҟ[XZҦˏ zU4~}Z96HoiummkEϙ7EHsgM9ˮzI 'ϟ!A" {/tR|*Zhb"kML m^/#&y5ixʍ=BNiGJKRS O/ (kfڡ_SDm[ZBDW2 Zwq9;D7`( (L&G?7OTb'ё(h0ݗs7ߡ0iiw҃4e⡭ ::nIŦ$HlV1ŋp=t߆Cr{i9hUZl? ΆƘ8hˁs@D|_5Le}" [کLg+~^+ \b)`C/<.x& y i@k0ޗQݏ'څij+nf:o$>(@S`I8߉ -BN7&zNOP\dGfMt{>'_5@lT{Agy:ײZ:}[d8աrYa#', 5A4i Ch5[ (O"VM !K'rLeF9Q 2N} O#d,cia5q|'($zqg{3ސ W+C%cc'MYݓй*3c?l ?yGᜇc6j92- +0ѿAp(eCԜAP/tfMiДtw _xfjoCɜdGҢmv1]0`ϾfʩHIS`zzh&H4|*mS5gᩝ8ȷ%ש3v(TxC‘" c6Xpx~ Ƈ/1.q" zRxT&/ǦsXFP-fd+ k0.`gĘif7⯶lTo:D.jF:j_d,x\e"Er 8\o˸0?glZA.>Kɰ35JPfJ lh@ N3P (;vp8JF(. [~'Q.ް]d\G\Any]v&ʍ& JCZp*>NiXkWqNeת[ǂ*F|U) 9{0[b2j_±Y zW(EC.pkA Q9gjPi_)Kkei-+J:U&ji-<[~q޷ŁB:Q0^b~{&?sѲ Z,|p?5 FgqJIUL:CK|?jx^R%6G9ޝb7ypv#};-"UkA0fq~r=963~p`l)h7șXCMᕨCe cna`R$ؑqۅY0Ɍ!?V2н+('E\_A6#epou}=͊8ZpUA')B:`;8&N/]\x"^Wg B h_ )hGESA81 wI UXsPG㲜!?z r1z$L]BzJ́{_gqѨ;0(gT0] 1ǯZSzޭ^SD!дrՏT9_YPث0Z9؏I> O֋$ɃbI߱wlbInUNtPdpjʺOg\x`Xd?J )c{i8\:]/_YI0Dr.<}K}FKlʼnrЛ_tŷG%I)w^i5ρUh 5"'Q,K1=shdyc><7ܽ+X1U8 Reey֤Ugw 69oFUr֖\1p 3:w E}6Ɏ8fď橬9w:,&.|}vԞ!oeɝhco@  X,~bؒ{XZ]]rvْκA[JT}nw~`4ҕ8hVf :X6j#Uy(:M]b"`#jT`JT &$ Rƈ.I|R|fHM᩠7yk_4>m ^;S^Ar^-#n;PEy\/ o)Kt(j|#"_ X/(d~ܵXkJΌ?; W/@) '][U+xDMA{EOBŭlkUޝ8) M$@h28ǣ ^ 6^ݑѣXQdG7ŀ.ZoVj:BHL 1DE%:yuH;iti ` U.m=YKb0_ھo|3q sO$9 * 417Xݠj&rp2& ]q,$w UJ\k|"??tjwEϝ+'R>֠x~ A'):JXpޯ7-0?O@#óڊAٝk/qYBZSu$\ q}اTө[ˌ!]?NFނ{'.oC `߼O¾Uvb>͍ier\oC.3ՖZ,:b  iagt p gZ@VmU=tm7}+ /gJFmBU~.RwdБCbWLܴ RҺ,/? =űZtƱ3D=g{U:w~J8mSM;#^bs{h[ [>:3|jz3L[A{^'4!5Í*!rzRǬ=c e>.)+KkSS$83'J4J$2]nQ%;PYs̟id䖙zJpbW2{g]KkdYD/Ma3LrLmr*mH6n1AfFCFhS.( 6F|ܩ[M57lRw"Ze+?9mZ ɀ`wQA׸R ðB^kELTc/BS0 ʧmֵTTG< #?"\vyATACEwI[-Dܑ)"^UN $(aoP_2") Х!:bzډ@hSN$1{Գ6bA`3Phr\[՘pO<gL9fa E|W*M.e6Iu65t'Wjr' /HAYmt t$ U˟0,:GȌ7wZ3Is8%!͘ۻyrIrs-_gÄzWMS\ Q1 ?ԏ_GdrP*EuS&>$/L|0s\$ Ha ^+D0'ϋD]c KҀv@-FDALFͰ!TqOH2O{Jd .qoc{pQ GBoV[n r Ĕd"y>фݦ;Ug $rㄡ,}DVHtCy^\z8^ldɺ$NG)Ue2bHR⁓*P5SȄJn#CgDq,'PXؽ-~RdG\/B$)7.%s#HW[!`$Cn@*?ަ)ؘ,hO@^n뢭i8ì3ր ?oP[PU?`\v{牽jL-yt돟yƬaS}3A2d6\9;ؖ-&W^zWڬIV,wCȢ. z1!9J#uez '<O2_ { 4wvx)}WpVa59%619A}:^BȿhpiO;#iiH(!a򲪒˒(&8Xè6!v-A҄d-6dJlS.pvSj%U!W<} tH럾Jk0 33tej]^yoWO_.r.[p`6eu/QUݪŊ0iU\wC3|Jh h)(*uUEjj,8 HnA/}3ܠ=x1F(0_,ʙi;SYswo@5@d꓎NhD.&v]&t, -y/e62)@'ww^ n iy2Z5ײ%Cgc[U72o-}?x`0PsD!\,@X'NBm/0[\_*6MgYR`HvTO;,j8BpK}ob{bz y QZ󢿵0 Ʃ`(#ZB=b&֔sHR0)/K>n ;pidu,a ǫi lIZ&Ʉk[9WM>qMLq>z2 O ?Σ? X"0ew#^,O :]Rv ɳaNQ!u=x/n/sK]{VDF]4>=W+bMWҡ߬ w kqxo[Xd˩|wU)S2ר)CʘIg7łyWqAGRKLQ1L^16\:D-K7]XA#Fʣ{n8Titj ΍18ܺ.Ǣ+V ɖkgR7k1Umn6-m&KsL Θk' :0۸s@g2 #9XG潃h`1Pw2Gn&*`A*2/bu>6~\ɢ{MIFM.c&mblAS᲼^ FRMMcRCio(en>gƞ6@S$!|cRBt[-?Y4Ī;&Q%ؼ&HPם'KaQ,`&m5}c|:^6zWZٜq@@/FmԨѦÏ>aVg,8ٯC w Mτ1TһzԺ-^i1)f6Mv8Eb[>(T0&#I!%݃LS[ 4rAw>Y})?bgQ~>Uåx$t]VP824njW%z9vh=,(X]0^e\U FHj2SFy8d+A0U.Kӓ#GZLyR ^sk*@B74n#7Vg28elȑ*Ӣbi|{3 +sp6wp Q3[#97Yy ^ir# fgd~ 'p ~<}/<׉XȖSnymj4.֙ɹqQIУƻyPZȁ(0Ee`A]䉕~ IG~/W1QQoi 38 w3L4gxtSWsz8sR!v[%tFCDOڶ9xFlr\MǫKWNw/\E6Й_. Gbs24!7Yśq:j8Gu:SHfW9ʢrpDQ'MaH++M32yAwŒ+Wj[6Te11I[%3DXG5_u vY|g`{@(і;C"J oMn)p4537 95)58}>x=azջIr1M#;gMdfmj%#`,,fs3ڗ+h*c Ky";0XgU&0"(!W $?aXBo+Rn︙~+|9},wߐhd&wAqd* ׵tԼegF:ʔ-z~+˟  *M9{pd|= Y17~D8L^ߚL%38luɘ_ODO_u r~3pZu`@_jp*5~ 3Ŗ],S`H%&3ayDCcVpsdt!@X!v?ģ%Vg\D_]KT5?@Y)ݳ>qlq8[C߸ ;GİpJ$B[dxYԅ\ h.KYi Z?g)E^alqfF0'j?F!KBƴNCg.7rז1 L@`z~uơa_FF&44"Daȷ )3[WI.& QtT9VR W4}Ũ) gu G6ۭ%dsg!U\ZQg(XJ[1ZZM]Ѣիxy5z_XXeQExU@L #X a;n j9! B&~*005xGNJ?Vfp32=SG?ÓmS[I'gq<. xBF`jgEUr͇%D3߃2z#ELl,E= ~R~]$wGBāje|zhAh퍆;x8\OfO.75io"C_u;:KCd72+{~'$__v+꼓 ޕT}wڠIb_N!6Eŀ_S ڀ2!~9lPC9t>hNy($Z03G8 O]z@+%K(jӆ*Q'C)w3FĨ,m rsġk2Y!6_$Џ®g2NR_:emt?[6[LC(4oj&{ @eiC~dHnu3_c3mيЊ)-?1lv2 >Mɶ:պ*\'Ǘ^71O|U>]|8ς!= 3P9N'.[Ƃfm 嫻庀@ -s=4hl]\F ^ Kխ΋?;[@\Dsh3l9$o:J'Xv|?ZmC4wcNez܌aGZ"F nb0Q5uPxڍ` rm:KL.KSPrrubT%LT'5G*K\;7 G|4S9 NPhP@;]@?ɫ}*D;W>=+= V~?C]ObwH_ÄzsYr559S9p~"֌)bCq􁉑%g ߧ,k?qsDHZ)~!}V#>RԨϭAk):8_ZJ1{ Up#= =&AE#_W.!-zֻd`,Iu\1;~s$/"Jl>03,U-W어NUpyRچG |t%x Rد-2?(Ɨ-%7_\hyQzi_Ba" 45{`2 bE:&AoI}zŒh*O]wZL ,u~` T\/ ؛[Kz,+n)wszѽg˪?ߴ ̀6-KICmTpFI)$-=eվ z1XsuVlQ/E-"1uߺqfujkt՗%Z. UŊR.¹-uB@OBiJZ#weV^N634h| /$T-Z"l w+s7ShltSi.d{46:YCL$=UK=]E@Wrݖ)Z$3Y@^daٓQ,ae&vqG-6LS^'ɯWc%=6Bzǫݦ-]$Sot'W>5m[bJӉj7\mPXL]3]Ḯf`!Sκ!Ѭc֒Ec[oa&dkEAeCO7dk%g(& bVge >8"1®ZrHujFn1_X *^Lr(Zy;8߫~i5=C\J<ú# I85adiLRe LkVOmkEʸ F8/,d Y 285FԴI7x&Ԅo_ F+V!rЭJ-z f#C9kyS[.>h=kSh= ($N4?׻eY}VLN)2Q .{S$fݕQy;9ql]kP_n̅rTz"0Hx0]c#%)r|СtV~>rN[AŁF[,Nb \ؓY1KN+C\ P`QnTxA٩!ud,ވ0"÷ -N<U"yL;'U39)sBhɘOEs>C8RCm(p8ߞ=2d[ѽO0|rP\4 Lơ_b.óm6`4)^ լ7hf I`ّcAqad ;!4Yu{"G m:0_/e20i;oa]KE}a,u\ *1P̆pԮr3}.U^OR^q|I+`Z)UpMEG/=~k-4H|C,8QuY'-\b^NRDAIr8h4[*L"n(pP﹵u$WB7@:W%XO 7tpQ;KFKבQ))6 &]~n),L)5-#q7jb{V={3zY%`6eM'+G2߆3@f .A'g7 w{eXm9J-4T\@`_rU<ZI]͓N;,[P 猒-O zjR&3[Y%dw&Y;GyuԻ>fg|?a *to_܄z] :"Z {J8w6f$^JHȤfȰx;3J(GHLf/й"D3pZ: >dO5:~`UyI抄n^| pEd+qxyV N:MnkU[;"+7.bʐk>;Ӂ5=bPWPEp0 W3^ңucU+n~etewKXCh3(3Pq1b黪S)KB6v꣓zFz tfJ4LXQ@ı鏾@Ye$w( G4cA)_t8M(V[ 2hRv;&QcXEEiEdS膅VϢum*qƍNS"[k Ԡ2KvƺR[-(&n׻pQ`*Mԩ< :ST_&= Wst@%QQHybo'gù0)!ʬ/X)Kl'+ݶoV0OO$暪zXSH>cO]|l4Lɚ ἶs}F5_>)^R4BX=2o-7kEeJ@;[/ŻDrIJ.U@U8 yvTeNVv)wGc7UM4ƺJ܏Z۞38<(tX8E-25{:4z3U ۅ%8j {T݅O\&*]A;@GArpLYĿkCp] Gީj11BȀyXZעR KV+wI>8vuP>l}J,8bt`%ϯLW>kE"PE Cٻۨ@P6 1gcr0e&FCF# {: v)4q-"1H%|@ZY&@ Y%Buڟ\N̈́#f>e;(濚T$/lC p"^w Mnᄃ ?M sj]zi~#`bk~ tjW{RJ-H5&-9֌i kV",~K1lJ?PpHk_m(uҏCF)Zc2Gi-w}jϊ>J}3r3HG},xsz6`|T-vj%=_:>;k_/u5tlč)I{ja.xNEIi+D$Rӭ~^Gዃ=ⱪšp(3L=-:4 *\;,3[ Z<UehvXJ%;3`%@K* %NޢT+Pt/`}؃7h8P ʁ$H!~jv?{P(*ҁ*xl0g子Nlfz/eݤotsNe-I$3^c)[zz _izؓG&;ϞMS`ncIuD pByWHHm9HHeiR_ZFpG}VC 䘟=[ы@M{`/ ֕6g(b5_ דj ƯyFHh $ .=9k]T;IJ 4@1f(Oֳnz'PMLgR! ed@3&KxJ۫Y{˭QY_1Gh ؄!#R .` J'psG8ƻj/cɄ?Wgt/]^ ~؆$//)GF4=91Hd2N"  'y@Fk,L2CZH6{E5 ȡ׫ u ;-E鯊expXKy_҈+B!9k_!jDzRf4Y,7۠ tluDq n7IcS*-Tg]? 1X+L0G4Fkڈm喝Bh7/ h_ Yy |>F{ؘI.h- j'&Yh-ֺ4,[@+pq?R:_~uGO1uDkh/,j+5s4yb fЇ|)tHVJF*oEo¶^ Ԃ7˺ϐN;I@M .2~^WEIgL:뻏lfվq)>kA]'*?0*!D39*{)a3$c}mjzz={7z*EHHtfTOyθ<J  WĈ o Q+ldM~y^Ss!?;ͷq{ujD#֑w1$Q_NhhCVlV0b@QSw@x_k:' Wg%!ܝB}>Ogg]$YLn/!$fÇx]k+ӂv/e2:PA]HJ*0Z6Y#E[Z)8èjkLͭzL&L@cM(aFdPNF 3>Mc8U87pDy'8(L" #"p2>7(R!Y8Gv\woq/1?n$z֫-*aaT?0¯Ԍs玳B8,vR? |Q[@**S@ΠhGa;jԓ43h`,]/D $Y<! ;ң!2l'jH%OEnQD*J?og32$|ؐA|p>E ;.t}Ð >G?C6˪G)ϼdz;]:MY} m1:PsFPU:?g5KEjsW2k m %,KN8xLhnC 'uqɧ<%t1nct/{\kTLD @~f %OFN /@vRy4"3K >;ҩW~LA?ZtM+b~G=rd ꋍ(ô`k%ܬ*CG`ʻ Jw ]46`1|5|Y_ݮ,8q8v8efTG^=º8Ӥ{#Ѳ iǬʩ6G\Y:e9 ⍇=0ěCN ՊRz#xcu>H 1"XqmYO u;@u{&|C ᚟UHK` qO#E$4zT@S֞`!\0Ç)0FK ٹtwC~`r ]Hft,@e5= :mε* -N~x2-~፥}trt.' +81@kέ5^3xx%HBOݯ /g/EY֑(kfg0:|#PŬ[4rTЎn:bҰr#Lv: E J ȍ eBע~Mب?*#?9gXOM:n&)RݸXcS섘Jү42+V"^@L˶(s^= {U!DDa."L ,w/reKR@;mV< !BȞS))[mx~K gL4(ة'̈́fl<%3+b3 s˺1*w}z)\z_E߸E$"Bv.Iu} (fg;^*BfGW>ה` v^HUF(I,aBW1!RHmĮC sbWo*[R"]cKP=< ʬxnYG^NXxK^($Pҁy\ZL6!l[CYה>Je t-R! <٩$b7QvsS E[E%/Zn^w &x*4~?s8Kf1AkW]a0qGM1q0(tVw(||f̞3ph*$*X@Յ7 &`^=4"*/s &h%He_Vv8_-b\Xby-7׻h5Dϣv|Á@PJ37@lVLGSֿuT~[ cP8K#-A}a$? @+z~6h<&9=@a籲FAqAɡrssnZ+:D8o-/kC/`Jr QN*[VnZdyڹ`8iّl"%s }Fj9E̩ǽ naILH"fGtaK4nYQ " +z7wzEwdJWcH%v-V;//ƥM(Ơ9. Ytl۟w v#tөzQ"sm7snB@nL_V!YS=o%AD,Q3{IvsaƔ9%; 'NڅieÕz(|$2R [$|Og {l16 I_]̬Ȋ1gڥSBdP@$f)3aØ,'˫ Y@l )oSZ%4l,C?? %vQߞ^\Ѷx`B銑e,a1X] .gևdpPy9a{EL" QaEh zLZV)@b\gc ׉9.!ȼv:^*.4ҫgRC ~َ|!D"%rʚP:זMV| xmi3 ;~ûnC 5ob* KmQ^`bMdm S&+X YAFpKXrU ]4 _p)ȿ$ :0~H50<2:$J&@%ĺ/"=z.ٺ].q?~BYW%&YGuv4#zyg] 9YT!aFS$/Ҝ/3u')>}Bn#Dڬs8^]e/:ѐ1DW+f6$B3m7q0 pV?rPG=$Y\g#E5Zƾz3U1&2kqK ~w֮P'ZT<”^wdmzj7)ON'+qqśex[,1񠀫MZІG&th6B{&i?A(a0Wh@Ax.آM'l&K2mοz񟛠OvuM`ӎ+`bZA c6hb#8q+cltF#`_`, 78=/ެf8Aw:Hx L?SThR!2Kf2?/YwT9~YIFKIT7Dex'A! IWANG¼Eӵr5٨hW#Kick9hK=8f [M%!!Q7hG7NjHJngW% `eqaWH*#ŮpyIӾ0k]1N@\cJt~8_%fyW'f0pJ i%1uwIY8(S D"Vh[-f@[o}iu39<ѵBso`Zk5cYs[9zC.$鐘+d,AH׃B;3ω^lȀ+[{tʌ$ ~#@~ػQ*߀zP_]8V(e*2QfWB nB:elͰG5dn>w?oǫ>rI߿X&zFFܸ S/RI-[d۔"V$udrQu^k vՠ:yp<#>yE4ޡ L238D  TAY>c%fL nCۛO2D#dYMJ9 w5O:BXLtS]dӓ+ѝ/ @@e/kYgqChKQ_XD:8H2;D/$MeR+!<,rE/;ǎbh?'WW2ǍR9nX&V_8Ea{/KQ[2Fڸ*0(Ͽ+k [WØj1u)@WhE.w` {dLx'V 0qK[wOmNQ[5ix,K~tzOdَ]>G-c 6t2{Q )C9?F >7 jAdk*B‹zVD78M ,Ha1@^ّF&[Q:-bY(H2(}iT*w^Y4 I.t M${2.dFqkÎ)#&m7?FkGn+ [pcF%7{c3y{+}T^ VXTgPAtl )JO-hʼnoc 6\x$HipPB# FXnYƻD!<$"5DX|e ,D֜qXo6Φ;6ԔG{{BY#3T26\ 4,ז8"0>:*X2 \U+Y{B™ c-qXezzv g/Y" vl9 #سɸxDx3އp\0]¬=6!2^9Q2c1zԳCcIt܍>yinvĜɰ-rE1<m,׋M2=מhе{P׆|-#Of>>L*"PRL;c(` dh\4HYW*=/l3]۲tR%# ;"=^+Z6גj'0es22S*ऴ-@pR8۹n7Xp*]Sۚ"옘DYv3%Bq8aW˝ &L ٚޒBƄ48ݣbu6]p?C n1ER L2fsDM֌Y/'zڴ8Ld/OCGCwĨO;jJ㠴wλʁ4sj5>b6s5`q-`i[ѭV,JJ^O:>撦vǞtDmU ?!W:y0IgQjQ{F?(8Om]Y_4XվT0W:t:NB{_&zBTr]KɭIfE9΍"F۟UʓVDJՕ%k]RtXbbS*}&4k@B8MtJgSPW6A#Q!&KǦXFFNS66fHRpy 1v$l׻_Ii\fqh6htX68(VB|5oݶ F͐;v *13nz N9~gg: pcq^x4p W?f6ٳ҈i?37P˭d,Aɥ@K[婴b*ǀ.G`]JG˄sȞCpÝG"lۻIXnAįX.M/vd g?q8 -59쨿z=V/ٓƜ&xIbm{xM״UR-a$H藮S=$B!FvL6=cQ:Xs  C8qUrwT6;ժk`Y6n_2ؤ /35 Q~KN()~l=8;{:ZUSfW7nUηUk9"`wgě Ѧë^@ M3J<0u?Sڃ=E[GKO2Zƿ UnH!*o#[gfQ'EKs_4iڇ⸷(5Īi ȍf* FΨ* a)a` +b!!9y!bB`fgU*G)$8Uu|PEsD_(GsDl b ؀`f]KnfYf=CXS$4O#Hn~r{J ~(xPuOC Y$*ksB1OWCH6X 'B-4B׉*!Bv/i->X_p5Vd//s  |jena֮S2qixW{?O [+xИLu^Co` ohȏEl"g[7/c;sfўEv7)1Mjӛ`TҴ+%cH3ZOc);tf-=U[ rܷ$&ToM#[su-j!ā-zTuTnĔbT2B KӭM!Q]+p gV $;834oi*F9CSx*tU+BfY9:X !B%]+$;(S^.M@r]谂,ZfJ xarVjnԤ$2[}L[*c $ϕ4ҝ0AT*IJmLwPCw'hI3mݍSlpǞ/"Z+NH$#HLޤAm!׸h$/O] IZH Eb peNIA >(-TAw[l~b}cͥGW/=GP-`aOʽ _1W$2) $E{d `d [H~T[J2ɶDhƒ>ɖX>g'+ s/)||w,  &#l'@L8{`G1,vٮ84z PpY*SmW+v 0VudQYSNkdQ9iЮd6tkqJe Fk66rډ@d>%TxxWh+rUno$ָky rOZtO.E32}+-zh]mF 1|'eATlx\tasV:e۸*}ގƍZ){%NM_L2C1,YRn^#pL|`((@5Q2I%=&Pmȸķ/?4xXp 1t_O]OI$%Ƃ=hI35Y$NZw}"AXJ~$]d%eݞh?O!M/$ F -&2 *²$b] M1/GJG;* SjY_OR'kr_Ҝ_ -6̑#PO [9Oτ$:y;|drEFb85+/Oeၖwy)E5oهIRaΞncNp`S٣I jkf ?CZ W!8ߌ\A'U&HDfigP{ļȎPz"x,[P{X0m@#;2tj;i@ɉSg$,u8/ ؼ1tlTFg=sg+SwT#q{l0b< l&BgA U7dW6Zb 1nU=I}kin/'kB,!p?W 4 )ەl n\汝* Kf;&"=`>K,!DEC|ӹ$^$* }5q/Z獾n4e^B͇4,lRb=8QR[7 < Q)$"z"k-TGxc>&^1չYuwÁǸ=\Пl@Hz']oFYz+<%Qɿj zG[wPYYo Rz84̤wIGp8-;ퟀvK@.zR]7r(MͧU~\K˲(O!"&HRFm]nviFԪjX4x Mhx%P׺%R[GՃ s9d<o%FQ% 9N}Ty|(-zAJN:S?WH&2|u)a-i!"a| %ًc!2h ˦KB#al?L9zui!Am =C,|#+S{Wpr 4[vwTXa9KΧۦfEwP76lL`]Z%4ӁG{#R( HSG- `Z _uz |S!c.$6 SOC=Ʋ8_ʛxJ4 oLsH֭G'6Wf#plГk~8Won+uM)#rd6}*0S7D_=b<۷ >qir2 Bs_l@;9<ƬEز#H,gBQ vʰ4[zР;P V /#.֬q`/X/e>. e]$Μs{,5YIW0*xFzGȮXܨ;?pGvWq[ rd\BHRIE_ݵ~AWoRݴ )K\vzGm_a{0TsIV(U!EG—Uݖ-7١P^~29״f 1/QU[avLtd(h+˲wEBO[#G w#SzM*ra1g Dq%oͥXɣ+cꥫ`"!K>K*(5BK-ltT!8j>>-ʚg.azz-ATqzA@iȮ$Ngߪsjne!]YGGb !U5\q [Ӊhۉ@DẐ?Qv9:\PK.1@ س,}} Rb2ٞ@iztTw䄇|8Wtw==@Yʒ1,IDS>EUUwsbMs%=mF/K 1oy | C\pԖDž߈rHk1c[/A^(7U)磎zؾ|]I3`^=kIƣy\p08<>OsNWZG53}̗>Mf-GjJ3:fW/,yCQu/}6PSd1c%I}Ö wH? ;2#(ȥ`ṉ_(uyB@C0g,U<¶qGd.6-*X\#?H?q~f&Тn+>)'>ˊU;qz)?4۪u>Cl՞y$1n< %. cYAx!(o:Y#Vh #!j爈U^ah˻FbЏ${I|ތ22yGCw{}SY `Xkީ@ϰ%\7 mU?8܊+5{L_9qzRQ0 c鐿2 [0BW@C—淽c?J9ΑE+BCS2U\DkE5Z&͛FޞT}.)RC;st*Lmn걌EOyQģsc uNAӔ콱蕪J5 xH2&yĵd!QpSY] nt/LT-aP1+XE ?fQ&=PM%8MW_Ygy*z &b煦{̈́")QOZ@?vXW*{o5f@DZ'1f ܣL !hFOfsT29GI?ٲUFW#YmQ Gb|frx3]}&hKNݦs ;, h!=3hܪʠsz`2rWIצK,;k7-4[=d҇$)ë}*"lOt, +eK0ًŚ'=żd}fh憟僂3 fq+AڎM|0,}pܜSQCdPtE!JaZB,9OK4 {w;/ac7@Į GV+H>VC@~uWs<Ewِɧ%4w;ge7Dκ3 &>: !N`O-I7!FZ Ɉ%! 848#9tO.>2ʢ7qY$bɻC6Č`r:?=!b:G"9'xĪSWOUVh8xzS6ѳ)gDj)\CeUyM_x(f@ gtt]'&:t4\J'Ƙ F8 m1N}x>a#4.dˢmrdٝVsaǑSО iv%ZnC2rJv4bm-R1RºinoplHzI>dtAx/ww &|7ڠA{)9oLh%OjvӚqȰaV^ËT{rIWxgc8 π`9Zz1Yj~HW߁tzЕ,+q5?,mssdL4-k~2sɼgF|I4VTl{Dg4sE2xB1 n13nda ]e}]H9:jp:5I \TG_ ӳ%r5bbP0~xh]:BK>~w1H f >5B)u8Ɠ>nF]( % Ϙ*wkv̼Sf^?7)C $~0DsP9:'GUѕK<^x*5c 8 PFw:/(]ERW;c&mH[>:X?Lb6W0-ÇGz^oP}?x࣍E׎HWuľ}& O#DGirY-x,3./%ld>:V_4,AbBH6Ux3Pľhr㔽KɨAOW]Ijm\ eseKT-(gN-LsDzch0n@icخ;gx)&aX$\*Xc bT|`o˭JyɱG||uY42M f)b=Jr}lh<9;Yԙ㶚#~L-Y I#j!5qfc[O!孻kv3Cҙ8~h 7c4sjIܭV^:ѵae˂,gR&ljZEe(6^l3fΩI8B?keRX#Gֱ^}"1ڬ_Ko$ r<,oUWuj+滁̼! 5k&'K= Ћ!/Бh;?+кؚuԮI8v Hiz ;FQNt*e*R\ u`=n+!Eu)V\I9Z>k9& ab:葑s=D"1 \"Mk-(V*=*-7SorPK{ ѬS9輘q!{ j0`֥$)szm-`1'qVP4S""ZC=tPi`A boiG #/lg1AHu˽5_(&Ĕ.SRY#kPkwyy}{U_'xN5yuI:1Qsd,J{'j/idj%מ S3˴(;'[fp.CrDc9"x3GlJ[FPҞ.PMCA̙-q.ZD|8ZoȵpI‰3sx:ԙA%-Mj FgD)|ՐMދM*+ l7XRk``_}SVHt8~'9yaСca-#UTweȶBH4f$di*>\a8ИbGx>Jܥ ^W_fWn#w_rTud<( \~f~~'S:2|U3#˓ bu6 "l *UIQOx1W&e4oLX&E!LGsROѹWp26m,&>[i@jp RT`bq3iRy/M@iHȚՎc=RU]kv| {H%W[`Xj)c,imj>Q`(%F_ci^aș:Q Y02g<:PCFAMKيZeq⧍)p60:eSH3$f{GP`ITZ,)MЯ7 wppg(|v,a$}%0d%mF8Z"Va5[ #Hڍȹk4X ! `ilͧ)B#2+UHbyvbVѼ&TǾVى/wY.Y8}x U YS_'Ihp$s8;}ـ|eH%Rk6ڱk`9+5 p>T{3lXױ 쵦`@UE4lyUHX' i/ sIawXyC\Pϙ?=0R̮T=:vyЭk7|s?aA1ӯIz̢ eA6Ch6L'Q/Bs ī}Hee?6W)d85*3̍q/S>ZAe3Ł/,>+mp9X 94,<M]yz}JV%["'k[[P3J`="EpNW3}K?E0cTkK7YC1Bwh9uO־՘>^6taxB2Ǟ -v I m+>WOOj~M\Cg_2F|N7Ʀ'A7Ub$S[-Y"V wB@̖ur5?$'Y a_%NM-bYRf`G4oz}ؘ$@.}2?%. kfQ6355tZ\oE)9'5={B9i 59J*Wkx|wk=\yP}a0}|d:P1H0}O&Spal +03V>)t8y!Oe I˔$о3er4p˷`cke&FճJ2DƈӬ 8ø}A)FɈNvPspݟxAoA{99ИFt#, J4rlQjk- :rQZ7&bdR$8e.:gm@\sen"u>nO˪Va..ԵW&ᅫx>1XG䳛~/!P_CQFoi\(y=W]d > !PHH䁭>QCӄ&a4 j./ /*Cn WJI[u& /l>TX+K&舕 ih_& tȘtسKXn'-K[7t T9rnw)>@ s߯7pW>+!NV`Wfi= E'{\@cJ?d:~^P,YTrw+  #~^4ȒOͥ®'052ܥ\{݁B֒`@9tx RV:>vlmB6 Go%b|V.4't.|w. +ގٹ:gݡceŰ'ir2;+mrHFzaj aO;ŷqTv'ZmxO^JRGZD>ڲ\f4 kLs;ꕤ)T%^TNL#H*ۘf@?H-URm1(k2o \{d:4,BS`}RTg lJleFeu,2ɧH1 3nԄ?XYΦA<} 5[貮F6[l# 8#Q9"<(YקB|Ca4/ႛljX'"|Mhƞ`,TE ,̀\ w:xG^6nN4/bp>[-hy6DCZL4:kmn bL M15٪ɸ6[[g~bŨDd+#iS%|V56׶Ŵ:qF@J]F Ɵ.@ W(`U¡9-g-EG;a܅j8 6_LȻzG Wt7u)H%{5Л[ R)Q6uDߕ~< \*%SC0mOM`a2"B P1oP6Աeejm WB?`Z !^QRZ-$ۿo.޵qHDqnm_4-Oo)K^ɓ&ѐNNPZ 2{ǥr, ZGy콑7i( hK :y\~uO|;%Ὸ ޙoSykBTYXo)!C)wQUx|M+r5Y\G:oz3(}9Ş&P=qʟ6H/ շ k݆"qiO< ^s]Tct㭲~hˉ=RjYP 7aq>_9v[6C W @RDC8xs72<䃔yاrvtw%g>7i{{:8=BcO җTdO9I81o53f#YTV䟊4F*DtJ/o^]r ]̓)w+5SX#~W;8D.įۮQ  )}1m^Wʶ_%#F<ڦzAtFijA!ZGXV [fkn{{1W|džPQ%>(b~?'VJu0Ff]{i"6ȶ)fe\|R6h*}^…MoL;oscSKTl{;P*0%$4X[X*s@N/T{|uR4҅bx %ԛ͡36MT1V0#vlPG3}E,w(a F]GG v6M}*芹*Y7%,\3OoMDAZ+Qݿ_soM`0=cS/|2/L f>ģGTP8ym ::NC؁uT!X|*v&q %Df*kep8]}sU|dֲm7e~7hǏܔ:)3|b֐r"σ\esgl;b׶ĬΊ [Qjn 0)T 띏[^X=qLM$?.{ LR!,6I?#/$-4!lE9oR9jR@T f'Xjoub " -n S#Nts:S3hM2>,z9%}L( (77O=dƀZJdž'L/"ez9;i란oΧZ3B^X[cq#pXS+ݬuU3('Lme:A`톸Sp ګ[a]<\c>|ہOWy&RWM_*6U J.(+U^%㦋9'RC 2Vz-u@ήܥ43Kk0:9QSӱ٧W u[$3~XhVCÍSPe ѸOC>. @^Cˁ1mOV!N#:kYؚv1!_dcw[v|8*˅ +ne@^;3 ;2H|/$V^\,V?J:_ៈx~1]JY(mNXR|}-(1MzeEkTlc+,dVFÖE]Mk(RP_($HgjJu|{=a4NvPuuƫgРByu=9~Q&DNIKfJLYˑSJnpԃR. SYAs C[v_|C”3[+vޢu DVi#0ϩH3|)30Hja3bCUOtj0<\jaAʓgLl5Ԩ8 c^YJÀɹܪ8LaߔyXK`<$yM vn`рg0w47}2$ ao8`/SZKSޔ6W(CQZ5>o_Yp^zN;n wsa ?|}{}0'k(3x*KaیwB#[䵄 XߚlHy٫ >e; uyUe":LQ^]'Ǻ؏ % <A U/K5 F"U"e)N3C}VF< TQ. ޝOF;~(ෙ5Ll65=T~jIE7X!hu _ʨz3ѹiG$o|9jD)4KEnv}|a7E%1.yU*hDN˴U/Λ\&|.ż3&6ip.:S|$D Z+x}$41<'βexk}3[CY +٨Px.4E}Un$;_-hC7?6/LXFôg .vXh(?+twUg?mGcq|#EI$0%Kp'G`C}hvG$.[mΉA AɑQ! :}z<9lyIRtL'ӑҮz4"p }FFxG BDH\K 1K$۱$4eU2` !ٴ?sâ^c{' (댲 ;˿V A~DFL,4Ąu|m!셚 t2hU|ifsp^J dts(yCmZQG[2|XA:&XlN( =K򣇷j7(5 Zݺn0-iߊ'HHEԉ|e(^; h튊z>mG *<ڇs&'gűl̀w* aÂǠt=Ϸ18Y#n>YHsXLeN=~HSk!4m\ՂU59=tn^x.UzFE H ;RKK&\'{ /*J8ض Ch H,4Q~+Dh  ˼NT'RyMЙlH +; 蓯׍}o$O.U8kT1nnu07,gfdHB+ hڥL@ '."VGr#x Ojq.A+9a4(Cx 1Q%s{13v~:JM)T@ \"K/,g>V}|V2e]#"7< j%1tԝTN1H#3K0B%@r&)ek.> kkIv}ǥm7H2؅`e18j;PwU <6⦋qKqKEXN!'Q)Q>6Y4;?hjc@dowǢ!_6z6PaI9{T=S "kqZ3l;}TkꩍDW Mlun87-寵7>Duzv<41!' uO`"*Jwgm'QsƌF$D?sQ[I !2mu.bmô4{o {([@raDW|GੜgDZ))[40_Wm[iJn9} brvr`nS ډSZXRHP 9M.O!-ڭW ~Aj«CͿXSIƲM>Z2R&z?oGQZg%˒=3 uȓڊ~slq&yHUe;؀X(K]( Х;jsly ,9-}m @ ~PO2pER={ ȟQ]}u2T,f$b@`? !lV΁ eC' SmZGpܔSMHVQpj(F˞&3ʦA=`f䟉:-£y}\& ~~sjA8CGbm 7m'0}S $R=|09?J.+  Z۩3Cv/ tDV/\_: !ΐɣP?B7mtz1) g_33;BSI(7{/岱:iVz">SbIe İb D&L.cx/L(i Xj!%'yStDzOF~?ohHhVicɨH˻c/Lh!ZU7U Mt-1"t,(5(Z14"BH"/Q'[f2#(M&< q?0! J/RUQM)6x4hb -Z,n[oUrK w $nL gx+rcqK̆B˩a1rKP:#& ߘ 2hӁ!~ VSp(} U/aIIp9!jjPx fu:h?߄ŴǧEċEL_5'g; YɣN༌YPwZrlxc^m 3+' zϊy2Wb6=4y?RTpLLOd;Sd@`x[ 8K e| zEd\FY9rh1]zփSx[ ~o>O@إJݰ$|y5T3ڻa#x8&yAoXב)#QͣeS]A6 ȭe벵>zj$LE8V2 IҸAAk;10}/^Nqjzْ'5b,ENUibmYPO%Z_mM&jzؽ&?`}cpG)=F\:Ưj#c*줼5n\Ym1]LK'uG7$ kMGT:` R~b}P,J TqwaMTzX]t%WI641#eoY K3Ac ":]*<` [%+@L^z+H .?Fjg3g-ڨT-<`I3(/@CZ"aq/t*}`g+W; H;=:ڤͮ*yip l#պ_$g2doU"͓G_j.l՝ | E+RF,=j^xY;l8\?[q)S!uha7H.#.c'Ic E 1gPK/*R8ܸP(n,$h#Ie64I{'ОE@3jvU>O"La׭Ҕ7C&9%ܥ*d:F,΁Hu̸{jL mLJ| 8KXLDYi Qx3ZGdXS,᳒)D_Ŏ&gΛeΠ ĺܺ {g>ު !Ӧ ė>{W쑔ڏji,M:}#&sd 5'-(;V>q mT)W$yW8_E60%lC/^[C\{dokvdprɛH+|Ù8_+qQ}ҬͦQad B3ϱjI0_w]rӁb ~<{ðrQНjDD|qxKedUJI0!vq }ms(]&ä<=\siO܍:ILFbԓ.) V(87"(.Cu`lHV DOx-j-?=]u2/_S :zT`68(-zR ҺOa;>؛ ^QM~j]!GexYoG=^@RM`,0lf95#{F T^%%3ʑEzo.,0_?etqwȵO0&Ǔ [w먟wZVa#8Щ V wzS#9i`:@ Lv-9%Q٨vD8ёrJ@~-/![5n3\92LN#ԛh'[MOQG3O,4SBa;׈ZQlj\ےΦak@BnΟIXō\^JuYf[ ux3Kƌr 8M~Ay"s\y Ƀ N6kU8~&qRBNk+qb_ͬѬ Q>ZtbͿO*Ba#;+ơ"o2C~ h{OTl`j,?OHPaji PG{ޤw/qqf[^{]$ivMO.'Yi뉻?zdEExFHl{ZρۆB% QIf;]$o˓C%jye܋Nm>܄m|X*j0Nfd,>oj jY&9tI}ص/xِO{_Y!9\N j?ƿȱGPW (ƥ!N^ފ:&_f8>2ƿ3%JƪȪ̿NQ֐v{E\yne5%pkfvhPp`&[$3+q̖D9^/h(w},1\؝kB_V;Z:"%xإ<[` lOqQI67pGj sUq_C-P8{bp5%Ĵ~Tq1#c L}jkGXa]gsc6RXϼ,ka-]M?H*Tkiq[&L\L? *`-c>,Y76$E޽H[_Rú}=#>~ƫwKZ{n ! b@9P(K| QduhZPApĿ'YqUռRqse¢W[IN;qF%_ /AW ۢKdmKvԐ;3;_.=_uM3S@$,?W,.݉)J'+UH_@v:3@25~A2WjbXiė8vɕMv!Ч)է'{5 I5K!*(Q? &)Ae9_6r9@&Gt@X-nEmp硶͕lЫ2mI\_-p_=m?43Lu!KU@>R.KSjyp3eY*nb3@˺9꟪Yg0{?s~2&S4F*'Vh0Gfd]UO4e[o@nk?fߘ__(GŪZWSؠ<õ}"U+0sxBY Duqg.3ګP6 S ګ?UEgϨ=/dsE+k-m*5>伋l%΍c5|}ؼ;y1. XFQ}6Bİk x;}%Ml4gFyMX!*4(pa:Vr8va1ΨYvq#vLM GB>z_1>,iv9=$ptӍr^[?6,DiWH2&O>)`9LAGv=~[)-pӶۉ}LOM OGk#62S3))±m*{ ᭸4C){ GA>NFnkÏe/}}1A8Fp^A͔iуԩAIo 2}(qV;ځX=nLxB ~KV^z#EFN'ڄ Z5lXBi% FEL,ӇIkgIə6k,,r' s]g"f͹p+ UH/Y7NGo, oq,{$8KVBfa`nБ@rP;=5#?s\j5X7h+3ws5 ̒ @\ƦS7''T:;YŇɓ%#1y $0- /%7RzîI+BzVI MQcLD`EG2٨aFᄆ%RJG4} 'G\U-K n_Z;A BZ,3&HЄm`>WMÂTeD(*4^ƿ J1,\v\}%qL֭{u|aDgOo<rǦUx8tQw9K7k J+DJ|`x\)u6Ȝt:!L ܆^Nr[q⨱W ͸t$m}qfcod}[:.𐏣Anם7-FmD\#HYNBs sUR`*#8lr_kZ.Ef;\1cAGF@N &"nUV;o23\wM0:^C:cݱn!@Sv?lJ@mJE$D%\L ',g8F) [9O&"~d\l7g]ec2w`>n|"TZ\Ubkq艽KC9eW5DઍJ{z @E_H:hJJ)H/9g8wj%.G@-Qp@.Ck 0-թe-&tYKNH1ָ$1af= 2И 3;R(,Dz,Yj;r"ȩ‡[x.kNc6fI~}?/pN oDAL:T#PF7m PJ9r+RBj'IXTVoG sԲrHCB1 AjؼhN4;dn5fK19Z%y +MZI&hVhog`ep!17mvl5)=EK^ijّɱv_p^dКҐ2]\)/D6.B_7NEnVhdoP gi `Dժ xroc~ x|5±r˱`rdmt{WEC6vr,Dxb~?Vԍ}`Ot݀V!ScŚ]RW.[iSp?N5[O#ʔ+Q[«IkpdGh~ݪH"1ǔ QgE55UImI6Bg3C4)V.՞h F7 &˜wJ^6xBOKCZD&rB`ѯRs};aX%WePeIv "37P;lXJ16+XJ4/@W`8>ጁE/vӎ8UMڋem(#k( +e NKL^&97$x8:E#UqNļ2Oj;;c?l!hA()wzGqgg@v O XW㜪BJHM_@ $)Ge#L?`Ujܷ)UR2 d'ub%jmdΥz)4QLo;Pi U0Rıj?hմ Իܻܢ+ <0 S*˞u?UG&uH bQXGz91QL%ʞ\눣 7}?MyXK1 ͉1x1r!0!'DgH_&Բ;BNwI{%;jԿυk[Lӫ95TM =ԀRcYjMU etN:= aO҂(/#*֩ftX З̠;=+( Ƌ`"¶Q<+Zն gL[73`f!>VJBٮ4..;Hb=R{ Uv)p:DoޘЍmY>('vݪj*xE@6n4̉['Jt;ža .@E)fQQ#DCA[3f2?%·T1su}#8WTI",xJvlmig\/h;u$!]1;:ݝ ̈gwr`ͥ)Wb=(aܿz Dlj IC&$zTynh:]@&-mkowkaɧ3U?a'}ܔ*4-VO}'NJر<+DthBȰ,8e7?XWh4"Q#S,. <<- 9s}cّubiΌTG=ƇJ1`C&ϝ}cj((s6Uge`D&8'oP6@,A tX1Ko}?9E A!Z+ f#8h -BbW'sk"pS4%DMepf }V+,z |JedR:guR5; U>o=;⳻a}#@ {"AX)=9ZW~͏ԌX_zc;xj0ߧڪp\1(F'jm>ؠ/Z {2,0-{E(nMZ.0sւ6Rx"׭c44P]5.M k\๊wiPR-C"[ pBdz0d{sFhlzfZќ%wJjb9 L;1]D` L喺o.,]>ޜjL%{m0ͪ1NA]Юd t_NM@-ll\uK#k 3i4ώT憒챶h\e3Oɬxs&Kv1%}HK0&i/tY#axn& z`AgdpI8 tXC@ep ڧ\Lٴ[gҎ7M$#89'$Wf||2܃w*7RIipWlYȒ\T\q%%IZ>>@;`L|#ZD4k;ȢE[Ϟ1d{%cM:mbgx2ٌ'c}UdE #{@R<{Kp ًbF'^NOIkzǜv6S-xTiM826<-pȽgI} xj'48ϦXƯKHC>qtԬoAj-$d`KνemwA*Vm?SME9=gwyainfT(' W7 :|my ԩ/1qr"kΧ7Rc:c~5(DyTG'O;> /;r\<SJI(Fά^PtrNrSLXoŬeNG% ?8vzF,]luv?y-L >s+-Lu]&Rj5(8jU[VF9؏Q0+pA[^xvưbHv`0 SnGPEO 2.=jU[ZhEitm ?۶Q -i̒n.y*yӼ e+gWwVGr>Qw=s߀<}ngAS4iKKsr\\Nt1c0/fwc|{L#X207Tu%^,=AX^`dJ0n3giK_wꋙvL4^Ξ!B|SSi?%]M<{҅_v<|]&˨ă m-P]y:&E5%J>Q7-j' f7 yג4۷sCI_ @*^NPi Yvx|Ip,B5< b ,A/(W" 1mhd1H- 4ȳ jWPKQ3m"3J&e+mHc *Ex2_f>$0ٞËMUto1 t1s|6쿣7zZ#u.E> _hRqkTϣgS|ՓJP5Sa\5P/iP 䊦nW5U~2_gC|HqR)?HHRܝV ט-=!z*:yڋǃ}9K9CLilzGYl&\~Ѣbbj2iKuYc`@9y·ma *6KFԜІطi%lm$RTVIPg/}r}\,L"U S˳h O}(p}boh}8ByB'I27PXb΄}B&W;\ CڅH@$7>xߧK sYrWdA*?B|Bu3}2qyWб-ȟRn,pPnlgC8mM1s;^ݝyE+ !$):up`<^j]F_ |6t\7Sە?:t#\n|C>b-G^;PƑax3c8'GSBy7 k :UtM/&U8d: S %C"m2"hӰW_x@Ӭd.0 fL[5mP+NMznYbNgoKBoVJfd0b8m~Q&|>lge֬ut]׃ %?%uɗ~ \p+Xq)O5u)}}|ѓj[$BZ8HT1H-פl&E*Je: w#%b`XQk(;1!zV#2? RHc!=<"-H%J;mN ^*Ky)Zn'[p5]rtËB|<$;pca;ڥ!i0!UL VьnōMYˤI DAjO/9`nkާcK߽W?c7*.kkI4y(^7VmP0/ZL H Ym Md]Dՙ7j蜴53E5>']l(a|׶;.ko !+7\=mBSXۤ|a3h]D8\M ΁mS%2/% RrUUn5j<KsmK8Fpj N%*nۘ2Yo´ y_j{$i8^,rsQ7l S< ^g@3 ۃ8+T?V *VYaHr\9Re(x6 INLۚrւTa;F$\vM@K^ $i7}VMIO8xgX79Rbu?8t Dy$+C#ڍap6?8ɩ3-딐7!ȾJ&W,.,0`+[CKNggH nҥ"Cu NRbzL˷ $T(46McVunQ\z|n Ř gݫ\݅Y9Wpfp+^ǰ ji"WNr3!,NϜcҌEGseãz5۱HzysςH6;MWi9֭,96f Pf3%%kM$'YF^j($UJ?Jxdkg /RbLoE5 n?םFzɢ*^^bR3eE-*'Qz"=+L?`6`K4t_s)NGƃf3FI gSTUYkk0 sѼXۑw$j;;#EÓe\R475TJQ^ת0V R]M˿ha'®,ڧjde_m ">,f~V6U뗓\jZIm+IЂ&Gu nČ \S֥ O4d]r9)_6JEtt"WkFH' VW鷆˳?@ULp=&C{Б.>RInj_\UV!µ_ʯ3Ť t4)G Nտ&1 Nvf0t xN09@ ԧ㼒63T0Byd (B=1c T^F6&dqE) 5lkYDW3H)=E86Y9e#$77Fs>ȧkg).#c@'tOкØI: vSeK2;̛9< ׌smXw&5 1/%@SΙW4ʊs>1^j(~L (N4Q'ϭ?yZJϫ|2D7?db?;!zfIx;0 c;pYR ۀ:tjTstHz-Z ڹ}(x0޾Dg^vMF7?uCe ] O uՃHgl'>*̳ʢ҉S v"˗ӽ\cĦ?꿋\(*IuEæ A>QPM7>jvrn5\7JSL``{;ՖG*~rqHX 2ͨ ;զ}v낍<$qcQ3/MyžF_,bJގ 6A9";0U7}ЍԿNp_t~CʚȣYW\Kú3BwCEt%MX1{ +ҕ}_ DMM'E+pE? F띙Vmb>h_ UoSַlqH.ݐA@#gt Z$Rck ,1gw0-Ѭ MqU931[LPU@t)kXL9 )$IrD ”u'MX7 {K0iFADs[^_񢆅 ojדٜ2֫2xYYRa~&a8 d#~xk{~WZ03K&GL5OP&SCl= ZBiPg=ʵtD YATa,5 n&4:>8Z].?#ֆb/ XU~Ę]qZ*ؗٵAxe=/cX%Up jBa"}$s J֙^4: z*DJ'}_4o;"Kmut fQBs0b\,X3ȚXgqGrRBr>6/v;F˼7ՉKgL'%oHVL96<1KBފȫFm/℄]g<¢9NJԋwIJ֮=x[*G:9T㔒q_ 4\QZ BNfeuab1B` b ~2Y;Ķ&QքHA8`*4 W:\2'?g=oC+Lwj^gYЎ IFHJ` [;u7?ceMvuD7T!s%mr%ּeͼ1HÇpkׯvYg _{lT0ӆo1ڸQ8ѻ K*.ʋNrk D=8`>Q0S#dY0I9ۋ"y9-oP{sJ)%azmjD(Q6T 5S-Wݞ7j$c뮰 O8jDwDgqc1զ'Jvܕsl,b=]wmؖIۧ 6["i̦Wz-s. <$C"n/n^3wFȬ߷ɂ"ރ=4j/4- etzS, 9@ư ixD:Ysnܮٌ6t Y<|X!6 /~eɺtJ*rq}"Εs Φ 8 ]*袊QzD|AX&Ep] >aVu׫/$h+'蘛;YF s''uA E :FvxnnL$惯x|ߩFìĕm+3q,]"{=Y.>}]en ĄܣmJ<`T -ӈy|pQ6QGj#RGd;<|jhGd&* |/^ӂjVL)?XIOS3Sx;leL-qj<3YШ,>88`F1@ǽNtX/kL/"XBCx5WB: T6_k!UDp0N"ݟ灡Ӈ%I""=^I8-XzS<^1gO$w۳+| 2(Vǂ{('#k{TP_LJ ?MzT6F+X+87!1 s-#mg](֪ia ] eAepsqܩ Am@?^0} Ȱ M8 4 2Ԟtψ=#\KVƿIz&De<*l5?!bwp1i|Sl IxfU3Jpe-#?8FRb7+;oRef" ZjZN!N|dN` ѹo,xl~n rBC\5˶k~!(ׯ']x 8,OMJi).s_ H\abO>"[ąys;+`GM;8@#.;7"ul-xn| v9 }h]?2}5Dz[KA? Ko~<jjXeN$#CB Uzl'}3#Yw08F'h&o&Ow }5Еb\CNL䯤\֦txdnX,FRI`7A? |DartcӦB: $ȣ;{T/Eyɡ\Wa ~HYϬ1aKPv-Pc)Ai<iķ@7xe GI򂬀RѩxsHJ >ORE5h}o8-p0'Gq0y t E,NO9v0M}늬S/q ~%Dm>zJk bI"ip48x]}`QA~pS[9e mhf䙺j^OCe cDl #l5րA^8۠asV:a/CX8:߬ic!< +TCY!Fx`Ͻya&g0,sjO K#([(lXNVW=8rÉG nŪرWC]ݙbspdN:7/P#&TU':=%D#E疲1(]9&.L+{l,xm'mhYsb>ru^T;IJCgƧ 4~m"]k8ni1r?a8 8zN!H~tVLQb}=pNi׈A7:I1G(5xۈ; "}<@QW4&C?^)[E~NΚzWV$mitu{Q2?kSiCG sTha?Iyl‰ۀGF6 ohĭbhW<2:H:(̑wÎTe@}yGObQ̧i.wr*96;D?; j *RC 9Mc򂖀Br#i.ݔQoګoV0RT;/gHL\"?2^^MQZ/嶁KzAMՐZ׽ F,+yo>,Ҫv5[ҪU$t,ZqHi?$zZoV2 ߀%󔔪C KFwum1!`}pxk =~VD\TLit=AzxП㽟KF:xuv@#l ֘5Us 9,StFe(.dR3_urf-J+{|0v3 ؉*{:I*DmW$Gzk6YkzX2ZА~%_|D^XaBc8AC:%ϓFT?B^C(N9rGzkdʊe; 6 ; 8V+^rs͎5ID7`QFcvO9 x2r= b}JUS2BխjDT?Pgj[󪃿ȑVD*O0<X )BRSY x 'Khǩ0⵴tPyDHc EsB[ ߝ:c b|tw=ǢF݆C~2ãkϴ ؾKKag⠎Ö)E ͍ ?Yk}(92Q.E"4HQЮ`?oS+eVut@|é7ɉz=5;cC#T6ūjah3Jн5XU3$1nP;حw]rik?zc#3J]6_EvHS zxK:Tgb(= Ό.q'NZϙlu%γ F,Aσ?1d6PE3wڹ,JxͶ&g^>tAcj#!v$^X*Z&lnH=P".-0/G9"_dyؤ6oδc1|yk#xMKr %n&A(Fq3)99K5n60(w@(%jĶLah딻Q4ΌNxLaJ sg[9t NC pj¢KjHPֺv/hy~⿒pV?e}{($h(I;w-lD%o'k>+Fȍ:|#+53"I}wjnϛb w@M/yقlpSY׺9O'Ñƕ4VoQEm4@z(8ð571{>X9P?lZFUuy9I ] ҏg.[F뺕ë@n(P(.D%) +ܘ(ˉ(R_v` HNkxbDwBxߏ6i(XJF>Э&'i`$PP/;7aO:w9Uow؇SuF-9'Bޕ"y }q2ijŹ_GQb@FNQ7D XO(|7Vٚ讐>! ~ʠ[K2sqSy"x.8ΦK^ hU\}e"ٖOBDŭݶKlpGP"4|]cx}awJ~ی0`:=4˴u 7uT~1ءBP3BI&%$ r9I C7cګ='E bNC8#3+8RpAeT5@~Ѩ~OaCx_*nZeG~@2$Y$|y/>"ߓ'aS_2B SYʊӹ%[+걐1$G0Qr6a座x%O4ezu? ^8K}ảso,NCʲ7mt@rKCr0C^|!,8YFGT`-DB_Jd#FvZq-|\4X8$߇Kp[2P#)jN;015-HxgZ!9|?8@rֵFSЙF]n@Fxa$=zx6uB#,A&As4"0Oz|VS]& &| O< 4 _`AN9 ̽ .x6j?nN]HW?kk!*gޒgТ>d Q/ is)]/f{4%{XhiAZ\җf>AyFn|Pq. m<<r2X+ۈLAQۮx7B3/YC~v~yeeh v=@ϯ20z YZ