kio-devel-5.76.0-bp153.3.2.1<>,a'Ƌ!M@eee,>l3`SaW ZT$-|Bc^E/Udɀ~YO϶A?_9,[Q%τ_Uxa*0BP{-|ŜՅR4+̋f|ggIH NeςnqrW + R(L] ҶHCك/YB #( f3.Hoᭊ9gzf9cs}y,a Y p.;QQ?>>?d   L8<HLen %h% %  % % U5% V%[T%a %ff%k|k!l,!o!(o8om9qXm:|mFVGV%H[`%I_%XaYa(\aX%]e%^wbz"czd{ne{sf{vl{xu{%v w%x%y zl|Ckio-devel5.76.0bp153.3.2.1Network transparent access to files and dataThis framework implements almost all the file management functions you will ever need. In fact, the KDE file manager (Dolphin) and the KDE file dialog also uses this to provide its network-enabled file management. Development files.a'Ƌs390zp24N3SUSE Linux Enterprise 15openSUSELGPL-2.1-or-laterhttp://bugs.opensuse.orgDevelopment/Libraries/KDEhttps://www.kde.orglinuxs390x % "#"(%(& #!$R M* La<  O >"E'u $A &2't3d O/] O  6"&!"#$ ( | 5Z r2" R_8I($#9+(!$!1*"&   ! ea` 331 <w<,] .EE!xy &@. G g WvZSy( - vAA큤A큤A큤A큤AA큤A큤A큤A큤A큤A큤A큤A큤a'xa'ua'ta'#a'#a'#a'#a'#a'#a'ta'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#a'#______a't_____________________________________________a'#_______________a'ua'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%_____________a'%______a'ua'ua'%a'%a'%a'%a'u____a'%a'ua'%a'%a'%a'%a'%a'%a'%a'%a'%a'ua'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%a'%_________a'u_________________a'%_____________a't_a'#a'!a'ta'&a'!a'&a'&a'ta'ua'ua'ta'ua'&a'&a'&a'&a'&a'za'za'ē____70b448fb89b71fa498fa05d54364e4dcafaec1cdc6336e78d7a1a0fcb1b5ca0e25839b6f7398597755d8c891cdba1559361af46cc31554e2965356b43bf1629c36dc85e51c464085614a76bd9f11e5c334c1ce5d9e474daf8f966a9a1418feb0f7a77024075182465824f55230f7cefb45393ead4d72eb5003777532aabe08408f47af9e19b2293f6f6701f90f3cde752b45415215ee676489e4d8ed4721fc7479229dac5d604de5e968cf0f66624f24889f6f82cb85955f44cd45a4755da4769f5a11ff0ead7beed7ecf7332cbbc652251e0d9a701ec3d971b2d09b6bae24edcd774c4a1416f6deb09f4171faea3154bbdcc7393b8aa2efb75eabfebbea7576e87702a1360ee7d9b8452b6b4e4454e595290b3d0e7a7f573a0a282898ef496532421834aa2c0a2936a6a0fed2eadfd28047475d955794c787dea14cf252111ec7115e224836d9f28c381e43c51b8fb73b137b97fb2b07c473c9fd2c6d8759b77c9ec6543aad84d5f4abdb74c2500eee3c976af6d790509a48b0790211716d059e4da46be11e9d8e3e62b52cf90da6d3a765bb82078527058326eb18bb9fcf20b5584d59990a37a3d1a6563a3f41256109c7d695533a6f40421ec053a34ac9f7d1eadc33f60731f14a8311c358f465200c1c3e99d8503b5572170398f6277e2a8525f3f6c0aa6bfa1d082b72bfc3fc566233fbc9ee468a8dbb74f4bc8360dc6536d2047b30b8feea7cddf3cf559e923b6135ff0378dbfd5f6170e052b5247bf97fb10b172ce12b36dad201449e7d183451e6b85c751da2d8d9776943c3959391d133ec29533d1bc9fed6064e3f46b9c2fd510c685631e93f18851dbaa3683bb40945e41ae69d4206b7cba55613d531cbdda958294cbc3de2ac9b2b18e8c5087810de083f0000a60ca08a8f73920356a83723bb272d435d9004d6a2644d4129485680e23646dd1032f86228f766b62c40012f2289e9aead0cf2cfae759598f541387f89b394db58e5e5ac02650a3e6ad222c7e90f7915621561abe4d574b6e75710bf5435ccd1136779d8ea1b7228cbe8179cd853dc5ad34ad4a0aa49c7471a0ebc50d687a81a44dc4a25f65289fa04c82d2fc197da335310c6fcab4554cf58a8086f922ef3c2a58eae6a35389cef3707792dbbee5bd7a3ee3c98e79a02b93b4b27ab8b11591a2cfc77b09ff4f3bfcd3951588e5fbf56fa14faaeb4d993f0655a0e0445c35bd9683ee72fb6308b21b01a3f657a162e6ed1d70f329eb7e201567013e8396113354e97435701060f84c692316c481283d3d6a9cc332c8227d20e567d027644dc78bd62fe9872706dbf2c0c350d7f3655ccf4e2668206a5819051ab4fa38fda8f21f1a4aca369cdb5e0e8154d94f89a00ea00ef97bd27d2ebef2073384d24595e9983efe743d9871c4ab53cef43c01b31789e927704c1e8fa4345c88bc87fce0f97873078ddbfad4bd016f55d96d726fcdc943b484e0b1556de460870baec7bfe31b3f38e0d33290f01f7ab68f33d76e897da9d8188e6d81dd71d06aee666fd0eabe9ae7404cc5a1206d403187a738c59ddffb83d81275e2efce142312af84c1488fb741f051b88b24e31cd6ea560ca92465aa9524d1f8df04384e336143550d8f5ab7dac7443444c43dd5f11dc251938fd51ea8912a7e89fc04cc3369213c53ea7cc7a61d0106564f680d03befa2700706b108b6c3726950d597ae46b28583ba1d9bca24ce0e2f3153e0c05f644fc200a187281d9a9a034e630c20f1b9febc2046d03b9d25f0d248733be5141607bc5d9e157b6576809fe3ad6b51c08b289018bfb5493761f9bf591f185709f55980976992302401d553d299c0667a567bffe5e22e974716175fc4dddd8258bbab5d3f60739f230e4da988ffb0f821a4f9eaa60e8f5755b6cd8b8d11870df2dacb0e1c667ff321c03153ff1e4c498dfdaa5c1acc95c8914cf74615edfc6568c69ecebd1b726f609232c35c473628e9112399e3e690821aea930ae4191edd43e8d4596cb1c87be0327ea050c1c5102b0c7b4fea375d9f8af9c9ded3cee0879cf143cc341df79aacc07720efaf8d777dcef588e2016c9978f35ad742e70f43d0a87c16b131868a6fa25fc99a0bc3f44d4ea499a1f4d200208c87ce3a76518b9daf9c3bb6600ed4e35e95d4653abb0a65bda0d6a74995c28734efe4b0b3f6d5c6ad55870852f45eef1163490e58c3125a3cc946db3f496ff99ea82f80cdb1ebcb78a501b2389c841a141f592fd74c7b80e56d6f077dd76e29fe5666af5f6f3d5fa2d7660611cb4799f0742f29a25203a28c5b6ff256cdce6a11438af1e63088c690c1f290d4ffb088f8e5ecec4faee78f8e18358e33f840c27b7be5dc63d14082659a9e0016aa6af301c5c121704706d7a64bf2f02fdae4bfa318c2079576b49988f7ac73ed896fb5e269f1edef5150ee51c3a20f1703079b30d30da2723fd2121c4d58e6cd0cc0141d1d4f408fe560230be30d61eb10e2bb5ab851ad53c41718564f04fbf0af22c6d3d862fa73df4e3949bf69fea82fb00e13802c03b45b1f84cfcae8cf4544d40bf7a89bd14219d4062602c3d33c02fe0410aa456a262f19370967e6fa7cd957b22a354baa1601f1f1fd558c15658982315a96983bdebf598d1fb56cd32db01ff9b7793c18c8bbce315cd9cf9f70bcdef1f32963e775e210de8ad1765e20b0658390093a91b6f2ee7a48b17f2dd1d2a1cd5ea54bca0a91300d02988ab87a3106f9dbe83db4989a0c96154ef8d7c3c911822fadd40bccbd4c172af3b7ce60858fdb71a22cf770f96574ad2e075a37a88ec8927f61b443b77587f0a7cf7f5010edfa618463090739276a91440909c14d27088a2ff5f3cb1080ec52d645405051376ac1824c27c2d7e8a8db74f2d3704a8fff078dffa0b96a3dc39af2ac16541923681e1d96fde308892eb38cc29abc0f245645549b6bf9277ef663eb6e0416da5ed917333866f77ff3284969ff36c544ee299c773b8f5e0cb0c4cac682729691e4cb8132b201abe1491d1aaf796f04c2c2610dc7265d1ae836156a39c115a6b253498fb4e4c8bf55ddde90269b7613adfddb837889418152f5ca0dcdeda7354e6fa4c99e19bcf9ffb83adfba9862214ab55bc07075e1c21324b17acf02dea4474dd72382be735a1b84988014226b433a98629dbd4b6bbb4839f1033718c93e5b724e056d4f8d403a8deee39654cab1c664d3ad27e0e3ab87f8f82bf93a5f6ca4406cdc2496a1eaaaa5f413e9304144cacd37ba404b9170e75d67a4935a3d1735707c62afe8420fe77915881772b94578a32716a25d9bb860dcbeeb5f42c7804f70285272e1b2db96aef23632bbb811a0068bcaf4b842a3c817101e95a61f04e31b5a749be3e12fe9e0b389076c7029c6ec371cf84a70027d6026283ee59c8da78601f2e2c281690bdd61845e5a48fefe364d7fc362cbd4df8d49134fcc9d65b548e351c800af3fb280cbbe70d779824a871d0f8c303f61ca355c5a3b5199e7de38f2a3747e8ef7f3171b5db6fce2b14f735a7c45d69d4a77e940f6855348acd78cb635713add3afaa61409119c8e31f7f5bea7aceb623fd51044dadd754a8eb38015b7bde5f0455d74b32a51077676ca41c9768a1ff41030d05aba49c6caf90d7581fd4327c82dd1a0366a430aa7d507a109f8569c1de9b8b3b320abbc5d23861e0d0041b6d72becf2c28e99c6b66b4372b228b2a2d338e787e78bda8c7183f8b0a105af489d8c04eddf7559d021c66bf49dc27c31d4c884296f50e94d9405f946fb2ce9a3b3eb75d05516afa03c97da9d0a4bc470d8158ca370fae17a36a400e682d7322abe05944c7ffc8e2c1641921e177a2b9eb90705824ad7c9a76e8d06c3b609174d4d09c1ae56655bc4e404629ce4672acf0f9c68be5b649498f89b3461e70d191ea06738b204859f1af1734607aed6f2277bfd3f6daf6ea94e5c27f8959d6c275133787919e3d7c455021bbc66b6efaff897a4869efc35de2bedbce53d6196f68714e94efa849663851477b0f8f9697ecf837cce3dbd5202d2a0427d852bdf1a79689b59d488fb895d710219c027cd0303a21ebe4ef5f5d0dc66c9c6a100112b318e5e2dacff77a100434728f8f7f201c38af27a6aeea7678a251f4af30caee539ffc042e00fd1a5a292ed4577d7434b1da597184d79bcda83429fff022d6f798c18be2560a638530245134366c63a78a343063bca2a79354f9d1798abf91860a77cab72c3b62230d59044b2bf37fcbb070360738cde9015bd2ea08e1505be638eee6d6767ce3cc1f0a2619d4e0277194123cdac69b5008c032325ebd6d00e77ad2505ee2a60d177a7919eb4abcce3324390c08a7698158f5f41a01647878a91acc61f24f640a0fee582b85277ff63b42aacb819bbb165912ab5df39eacc5747124dac01a427f4921bfd6198168d3522fe95a3b06727a28fa64994fefb2ae3b37def28096f74b40a992463defdd020666152b76bf3abc3c8443f36d46c7a9c8c8ba219c7e25970bfdbbcd96aa7211cdbf2e5ee799a82d73b023d3ca17dd227b6db8f2934625c50416906afeb48a0a8b1fbde478c8756dcb264e3db3ebe137a9a4df3fd54e7eba733b5af2f8c8defced4986c74e66b8185d56f68778ed7169799ffdc48b80cd2d6d53fbfccb2a0579e965d24799c56f8e56c6677b757efc2316889a261558431a018b455fde49cf598c008e32329890c88dfb91cf64084f8f9c61f55e9454358ef8d08847ec1b3db0b7863b20840843451526ea0387c4a06ab106174d62776b120714882a254beeaec075147a86b4cdd843f8e63ebb6632d49ecaad9959f8b0e61672a74768dc3d413a5ac959f45f6e8106f58495905657299f2f9a00400aa38b803f3512f80f903870965c7b10163756a96a91f1155c55cadd2fc766db1d697a25d7bbc34ef197cb49eacc9cc8330c24dfc3e4c2948918a9706e08069be123c2231be90513212485ed0364134cc742e1010361d09527a147314b99d035246b84426b1ab59b88f85cacf5893944e7e4c9b56c7525c997a0d921134c4f5c11d68beea85602798caebdc06bf8816b149a5dfd35bf225943563443c9109ca2998333606c634967f248086dbecd136f730d617b9f7a1d50f9b2c50696d1700a9ff18f45342bbc7bdc2e0e671a02f0b97189a0021bf74dff9e15fc128fa61731fdc0af1ed756cf5547fc718ede3e3afaa3837afd304572a32ae85fa4dc0b3a2d545ff79769b331f161f3b500d13c924679fe92485e4f8722cc827446b9cee1463b76586d22bebff41317a88908435a5d84310d95246520b2caed5cc9e5122c694cde64a05313088abd0a344997dfb12c1b5996ff4a2d3b9d678fd8c25e9da9b0187d19f3aafa6566ba9d433ec73699adbb73fa221d294221676f14e60ae1f29f958cb2737de6ae7f528ce60a8a8839dc1edc42a6abf1b170880ec810242a9eec39e572d9dbb1a36d75b338f1a8acc2bda56895a8993ed16a6a1de01b4d454ccee534ee7cfd8577b83218b394573c98c876de92b4c171b939b79bc86ed12db4241a6d3227fdb18c92300151786aba51193c136b7c4f69c2c62dc27b0277157cb76e5997cdd13f12f8d08cee948997713e76dab5bde8875e2e549b79a9dfbd769ee039b5d9f3c5d4dfb67887f912611f451c048773ae837396a05500a8467ca2d2e0d16c82e82e873188f56408e4749ac9934bc81fa6a5c1c4c509e2763366e842228a42e326b2d6b54eb36737950b75a8b7b3fa411112d0c892cf79d963d7fdb6983d90991ec97a8e1f1caa7c59df3c5ab149bced127425b42f8c6422af76635561168d295ae3acab2e29d99f064bac974a3283a2c0aabc5346508f57158304efa120716b1c8164f9053f004338cdab1298cedc372c329d57a0ac53f7b2ce4cdf92d55d860b287b74a5f1f6affd9f310430f8d3bb1355bfebc8712b5ce1c58eb086cb0d69fd500b59b6841840c1c8f7f0d4a88aae10f5907b7663cb54c0a55a207fe2af854ae968dc1c1a8d55ad90e403098a86a95cc6c874065f2380e86c62ae464ad5c4acfa2a6214080566b53529b4a6c6e243ff511d7e647ee3771e2d2fa5b2e9e86091de8fb23b1c109627338485f9adf11b18d0809f9bfc07f9860fbee1ad1d8d99558a5408c9a03a2947899a9babc3e41850587c98a13fccc17fc6a364102c30af351b26e8ad4e3ee9944a1cdaee5aad5649fc2c74dd02e10530fe4cf73cf6bf50bb2c1c45121c4a237fdd809f9b4f475f89c535b0578c09b5605caaa995b897ae813ec06196c7fb1ed2d365f81365f6f8430f9489b26ab835c5b49c5894a6fd30f4c28413f1ca40669ea2f7d946668a2d383c3d007a2a1eff31abfb0726e1a4b7b6befec91e1ed64cc1b9fc1d43034818ba3f4b69393174ea94d299ee762dc79a7d497173d13cdbfb8df96c4bb9c1a7aaaa2cd87b180b3e0f5b99881288f8b86484d85eda4c74b7a63112142a936027531c6a47cadd68ae9f4e63da92b750a89849b4b4de782e96b4b021d83cf2166b445c41b8f6885e144f2ac64f7ff27cba92123a1a7b572592204c0d44afacb13097741af36353e58585121c84d222ee3b2244bf9740dd8ff5378e358f062e14eeddaf1813d7568f9bf7f64ddfeeac48557ce2c938cd906fa3c1b71ba505283e90d95fefe86499d7c25083642787e4a527be7381f43323cbec93fe85d828a27b653661a7401ad0706f02817dc360eb0ebaf80569c12f4fd77d6e47e5e8f3eb04ad1086e69beafaad2bffd0116e623ce668902203811128d41ed3abeec2e3630e1501ccf1e53482ca8f429efb5c86d7715dc3c9e4f386b7fac177c07936489dce4bdb1d88e5af32834135c58ad871119ca7c101d1e1db586b95f6b1afae8f2083c43e9b8b30be693bf8eda3df9ea881e0f1960bb5623be7a58fbc414bf05f800df55334e69c17518e4035e9e0662942465b0edb50320111be93de20ebb5bf960e025f0f1585664171601efb8aac3bc3f3ce707e53950ce505a7e952984071e01d2c6b3e4669955fd9eb103b789a4346f8c2628a42d12ca281697c67eb21d77581c2c18770cc3f5479e836f865e1e540cedb5884097274c9449d647defcced4237e471a845e2511771e9083583df89230df9dfa560f937fec90bf095cb11248c9f60ef5b840bbbaa90b6d7fca338db179c387d2ca4f698c67879c5d1cb4e03be210475f386fe6e5bbe409c3279b8816b4829a1a7ee71c56fef6ba96d073a6eb972b24fffb2c0a0687b7c2c827d5fbbe069004598e22246269b14797a01ef903af0ed889ebccecf624b325d68e24ede2bb7cdc5e4a0fbe0269a508444d82ebd036d3f37e2e21548082a302049ccda54d6400bba7ff40e77d47b19a0e78bc5e724bd84147ba16c2702a7d66cff6e74624b6f3e49b8b0c1692dc844e0cf774c3bef6aa657198e6765e7e440814e13e937e3fa6fb1d406418489ad191f1fdc51460a9354586ce6e3394aa0ca719df314c2b72762688960ae75fb72fa850d206694186d73b90a832304a3cc0a68c892c01338ee471281a8ca1421d0b7d89f6554fa74c0dd58ffd86f740262235e8d9f7228bfb9263ef047573d1aabf21632a366cd074688da4227b3ecc30a083329fe771d6f42b0192f9cca058579af9dfa8947e6f766c81f9d99caeb9d93a284bf4f282ed35bb0db4426c9c4ab12ce48fdb7392af0a5cb9b8822028419cc8791951b3a66387ea935ac226839a2cee3ac5f8c0915c6f5415bbdc878bc82b64511dc626aea41159c41a45c35eec0a0d52a0c5cb813187b3a9d658134ffd040c4c953d56adf247d2df8da89b69841d653e12569e2eae55efda09d0cb07d0dba4cc171bea89aebf5dc01ea099ddc2c4ecdacea8352861ad40af288f0313e64cb2db409c4ec84e728cc6231ab9bf6923edcce072438c651a3289923bb6b897f3501dca82e5d84b491c5b10505c51edcf109b3c8f2323fd758ad4bfcb8e53281f5f1aca5dcd7f072048dd97d39ab670d8098c37d27bae43bfd3d17483c73897a5c15215f270412964ee30692181e48dcb8833a1b2b89f66360d8f788cbcb1632c5cdbe2bfbeda2f0bd1302ac21b2c38ff6ce08f485293992ce291fb45a2053e03c1dd2e0d2daff957e03f4b948490ca61e51dfb5b03e70c6ae257b4ff90dd140a575def9485e4859f8642d7242734fae17ebd3fb4c682bb35e745e0157a1a79ba019e4b15c042be591ab8dad711b08d51bc375462a243579238f2c0c062aaace225d8d360310e02545b6a39bcf216168322aa71b54bbd3ff6477993110ce2deaa8d6425e5c05b90bc1ba9df7a4f7383f2f497d4f6d209a1b03f15d6bd616f0f1830936fe8cf02e9d1e11e5f92f7e0eba5c0c88dc1a013b2b09e832e6c954435603b0445b6dff66b6e46613587d82b8de0a891628869896778f14fab70d96eb1b60b7ba5402fe61be21d804204e57fcfb9385ef826778fa878e8ba1a57713e8201fddb4abe7c4a7bb51b0bf92a4c3717b81f14d8c098d427733be4a4ccdcbf62e32e0f24c269a4c6639c7bfdce7f9ddf7aee2fb02ee6e5d42e88b8b4efcd66022d2610c5371ad10d12bbda204de0358ed2429e44fc72de8f51eacc9f57d8f3a6469518ad2f738b3d58fd6fea62b9fdc2bdbd7140a7c8cde95baa1dbb768448f7f84605248c4e92e9e5949c268631c43f6a02b4828d4428aa675559277f48f6779aa927bce3a50f5e8367906fa5b43dae54256dfc3d6d4dc0e2e7cbae9b9a4b0f9534b775f14a498a790e5dbc47d7e12fcb907b75b089d78eb4fc80e2eb596c186adc662bceac356e31ac3d5cc87e38d56d3b536f679572b65f0f2a45081cf791d114a1733f686fbeb06d22bcdc7e493632feb8dd76018f914d9b27a07b0e821ebf7b9a066e72e259f4827b8384d4ef65b9d8b1c4ef21b3f59c7516afa742fae1f034219541979daac2192a48c20794a0389d4344eeba76dedb6b4c36f80638caa1929ca77c2bc8af76ace1d27a2ea63e565f3ce7a797959c757a295fce3198e8d6b499ac89bb8c3eb1db820d69ccb339297e7ebcf06c2aba0b579ef63936fb9959c8dfe0a7883593a45e9759adc8a8bbed05915956dd621d4cb654c2b2c4ee6d28f5e2e5a10648556359ccfca808ea8bf8d0d21857013c0a0ed21922ebd37e9f40449081b82d7d32a8e8c8d767f95796ea254557c7922a5b9f7d3df537bcdbe20c63c2838b5ffd385fa68cfc30224316290046bcfcd261680f389ddf7b4a34f0760f229fb5bcfbb20a4b7baee250b7d9dda0b7830f54f7cc6d8e98df41437c59aa17c9a8ca401d9f1923b1782bb67022077b451d7ec1a6d59f988bfc5161a9281be51577d7f46f545c1fc3386b6702f6c4c1618e234f667657a7d467e4f2275b1c2e52d1a906fd32b60660a1f8ba22510c4512e624f6c2731e3340d4044882aa4f103a390bcec9ca149bf419ad38ce2bddced10694a3214edb689f6db9966bbd148ea54738b57eeed4cbc9c08a954ab9bd63281689f514bc5e81a48d641959ee85adb250fe935f0884cc9a4a7bb1453570ee61f0c13808157a15496ffacc352a28f09810389c94700d05481ecebe0a001bc10e70c8e097251f900eb106bb1f5144716c9a0c06177fb3c4bc07850d8cc10d66c54266f319249570a59e1e3aa5eb59b7b56ff3bbd22aebb23fc9e985fba4f723e5ac868bc42f15d96939591f44eecf02aec74efe68c12e014857342b66f016ee202ea2a1faaa86710df7f91c4846fd898796d20adb4d530db1e0c510aa43a09f5a8954e16468918566ac9938d26ee2441c5b88aa8b493420c1b8ae3da7cf117fdd85235aa04d129def98231de156dc6ce5946b0ac5552b0d8cae690d45824d06b6829f244572c26c261a13772eb76c91cc202b4a6017951339efc27769ed7d1d310de3ebdee6558d0d00d2d16cb16f4712a0fffd32512b00fa946c191c32b066f07e780602f1b64b206806f37c59265c2b734af3f0fb6db2506581123ecddd0acccafcf116c444ed2e645ed29c4898be406a84fa608d8c3aa9bd9b6cf87747f780d911c5084547334b6e336a52e005715c1ded7cb322d78d96a59edde1a6b956ddb689ed16509349143c101cd5548fc81c9a725bd94f3affe71761106570cb69fa7525e73bf82eb542ad62c2a511907db7c101289399d95ceaa4d9e2b8e7d30dc78dcf581e43f181b22577cd2aa0a020726d3ec3c61b313a70be643e1e962f10dddfef858110e97ee99f102e71746d7fe01ca99763aa900ab5ddcf6c9fc8269d42a9a5d33367539abc211a9ea6b74315bd9bbd16ef735c51f04981b1a5701ab8c069aadf51844eb024962a0ee3e3dfcdd5045e0aa393f4e853f14e0ed2c850a8836def3d3fd72785c1f247bd0b1703ee3f815d0e63810768d4d434d5c0b2a94456a9cd8d474d87d4468645a39269a62d99ff5ffe92c2cb7064ef5000281c4b5cec20a1a40e59ebd825a8f691691574d28544d107b09752e832e7e82034e12e7162d6f63f7787803a6c7d2cb024ed9e6ea8e41d2ff3042b82f09da8c298c545afdbabe6790788eb42884b6a69be13ad0b9008100f5ce6c1219066f19def6ce248c7958d91e7c2f6e6194d7326d88df91b5b8ac57398c9f2c2093254da281e391e560296f077cba07c27fbd9c8c736120fce84c5334fd9583f041e299697ad98b8530dc7b2f170a40e671c91453c5545f415f497d55094880dfe89f4d468d105407c82a12c806067be6ece28a089c88f486acb0219a7b22a3c7077aa06e1f2e0c872df9a5538e31b150b65a584b8a504d52b8aa2345e149541cbc68f959e063aef2b4c03d7d5e2e3b0dcb9f1b661b14d3dac0d4d71d32eca123d7ce7620163410829aeb9f1902694ee387085ef644023ea6df817c36a32236f7dc1e8b0c9467bf51e045d56e36265628596b5f14d050f23fbfc41fd51eb1b02b7b46f5e13d3e0c6ff76a9b934fb83f05b5c3b90fb21c8f92808197436704520204b9682476528af6ecbfb7af69d2c25b01a1d092b2670021163708bfec2a3251f3e0f4d4f5ca89ddeccbbcf823f1aed2ac46a5e455438430bd065c68511df7ec6f6cd473b56669495449287b27aec288938e686862cb1024a74f0bfd631ebaa4d08e3dd97336c288a7301bc918252b5fd45e37c052e6c5cf5e203020837d1b168e29f0cd450f1cf72393fb78d0ba06d26fc5a732a88b2406c9d6d4a2d9fcbb3a24976de54b1c43e9a4ec4baddc9c85796c4b8afb2eaf72e38d7662c9aca7361e06e580d38f09770f6267974714ee23e39ce33e110b76a162f0a0fe37cd105fe4eeaa364a1765c150b0b1ea3132677da46b45b40a4c1cd3f2756f847c6df5f985ff238d7535061d8c28f5928cef0d595c42aac419d0e4c1dcd064ffb960a1320d1ae2e7728b19dfb58fdd1d93da5ebba426097949195bf6db7f0a4f0a6bfd7e5919ebe8ffad5e459cd07d913a2777c2ef6a59e3aafe9299a9e94fc4d0e3e0fb3ff98586488857edf2626a0746bd3f7c85b1a60778df1e4b41d33262396c7e7ad29b335d71b371bd40c1733426b38e5f0a901af04b60b3abea264cafdf424b5875c25e82ba0128eee0d216a37b6117a0661713edbf09a0510cc92fe5498e67e239db08541257bc64313e81d7f0b09b3f82cdd78a326958e91079fb9af08d40470aa0769804f339f69238b8f2ebcab2abbcef4999072f73ea75a5493986d7f3fbc8f7818daa040ec6ff6a74398f967c1691b59b95f52c858d4657b5480530754c91bdb5899b19cf1863de37cecda83bee2b2f4ac0c428e041caeb8c8b885a2b35664c5ff9273482a0ece78b3abb0f531f44ecb7a3575fb90e75b2a225e0569f64cfb4cf2f3a11fded9d00b881b7c20a55b1693e2ce814bb883e37fc8b08c40f5fe3fe527580db92d6efd01a01d56d38a947d0aa6bff43da2d71e1043b78e4ead47317c9ae022a227137149d68f89c31c171853a05fc6c8248f68abad2a828c857b94d14882e6ef947c27f4afe3a3f43d064dd54a96a1a60cd2472bb8f9b411ae0cb9ab2dd0edcbe152f68e87eccebfd3559817085f47d76eefcd85c98b9ffd8ddba989633a1d6e1c6ef2281937a37a1c8b3c1faba833be8d7fab5176c585a9647a789e9c5b8f5b71d298c76b2836a7c1140d82936a2b9a84a537fb6ec933acf2d1e4b7850b0feeae3dea42820c55ab03509196dbe14a57d2a9f97c9d1e4c0c7d301643ddc775202a9cc3ed81ce955f216f8a694005590ccb9653a2cad7e30a12b4cbb704a9b6c9261328e22a08167665fd2a28481b168dfaa229fe5b63c97b55171c5fcaad2b5f03380ece66f5f417c1b14a7e9f769038d5a45a488ed2e5858cfa8f65e70fa48e050160b4078aea916941cf0ca99bd26aa2eb92ca0f0a6d6a84libKF5KIOCore.so.5libKF5KIOFileWidgets.so.5libKF5KIOGui.so.5libKF5KIONTLM.so.5libKF5KIOWidgets.so.5rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkio-5.76.0-bp153.3.2.1.src.rpmcmake(KF5KIO)kio-develkio-devel(s390-64) @@@@@@@@@@@@@    cmake(KF5Bookmarks)cmake(KF5Completion)cmake(KF5Config)cmake(KF5CoreAddons)cmake(KF5ItemViews)cmake(KF5JobWidgets)cmake(KF5Service)cmake(KF5Solid)cmake(KF5WindowSystem)cmake(KF5XmlGui)cmake(Qt5Concurrent)cmake(Qt5DBus)cmake(Qt5Network)extra-cmake-moduleskiokio-corelibKF5ConfigCore.so.5()(64bit)libKF5KIOFileWidgets.so.5()(64bit)libKF5KIOWidgets.so.5()(64bit)libQt5Core.so.5()(64bit)libQt5Core.so.5(Qt_5)(64bit)libQt5Gui.so.5()(64bit)libQt5Gui.so.5(Qt_5)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.4)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.765.765.765.765.765.765.765.765.765.765.12.05.12.05.12.05.76.05.76.03.0.4-14.6.0-14.0-15.2-14.14.1`lM@_@_{ _^ _T@_&_^^x^@^@^@^d@^6^6^]]@]@]@]]s]J@]1]+@]^@\\@\ \@\{\f\`@\Christophe Giboudeaux Christophe Giboudeaux Fabian Vogt Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Antonio Larrosa Wolfgang Bauer Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Matthias Fehring Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer lbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atalarrosa@suse.comlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgFabian Vogt Luca Beltrame lbeltrame@kde.orglbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orgalarrosa@suse.comlbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.delbeltrame@kde.organtoine.belvire@opensuse.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atwbauer@tmo.atchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.defabian@ritter-vogt.delbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.dehrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comfabian@ritter-vogt.dehrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comtittiatcoke@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.com- Add patches to avoid breaking text codec inintialization (boo#1134688, kde#432406): * 0001-Fix-default-codec-being-set-to-US-ASCII-in-KIO-apps.patch * 0002-Use-Q_LOGGING_CATEGORY-macro-instead-of-explicit-QLo.patch * 0003-Remove-extra-after-Q_LOGGING_MACRO-usage.patch- Update to 5.76.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.76.0 - Too many changes since 5.75.0, only listing bugfixes: * CopyJob: don't count skipped files in the notification (kde#417034) * FileWidget: Show Selected file preview on mouse leave (kde#418655) * Add bookmarks for pictures, music and videos (kde#427876) * kfilewidget: keep the text in the Name box when navigating (kde#418711) * KFilePlacesModel: ignore hidden places when computing closestItem (kde#426690) * kio_trash: fix the logic when no size limit is set (kde#426704)- Update to 5.75.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.75.0 - Too many changes since 5.74.0, only listing bugfixes: * kio_trash: remove unnecessarily strict permission check (kde#76380) * OpenUrlJob: handle all text scripts consistently (kde#425829) * KDirOperator: don't call setCurrentItem on an empty url (kde#425163) * KNewFileMenu: fix creating new dir with name starting with ':' (kde#425396) * Allow double quotes in filenames in KFileWidget (kde#185433) * StatJob: cancel job if url is invalid (kde#426367) - Drop upstream patches: * 0001-Remove-old-kio_fonts-hack-in-KCoreDirLister-hostname.patch * 0002-KUrlCompletion-accommodate-local-protocols-that-use-.patch- Add patches to fix browsing kdeconnect://: * 0001-Remove-old-kio_fonts-hack-in-KCoreDirLister-hostname.patch * 0002-KUrlCompletion-accommodate-local-protocols-that-use-.patch- Update to 5.74.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.74.0 - Too many changes since 5.73.0, only listing bugfixes: * Revert "[KUrlCompletion] Don't append / to completed folders" (kde#425387) * Update help text for editing the app command in a .desktop entry to comply with current spec. (kde#425145) * [filewidgets] Fix KUrlNavigatorButton padding on breadcrumb (kde#425570) * KFileWidget: reparse config to grab dirs added by other instances of the app (kde#403524) * Avoid systemd launched applications from closing forked children (kde#425201)- Update to 5.73.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.73.0 - Too many changes since 5.72.0, only listing bugfixes: * RenameDialog: Show if files are identical (kde#412662) * [rename dialog] Port Overwrite button to KStandardGuiItem::Overwrite (kde#424414) * Show up to three file item actions inline, not just one (kde#424281) * [Properties] Add SHA512 algorithm to checksums widget (kde#423739) * [WebDav] Fix copies that include overwrites for the webdav slave (kde#422238)- Update to 5.72.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.72.0 - Includes patch to fix running files with spaces in the path (boo#1174141, kde#423412, kde#423645): * 0001-OpenUrlJob-fix-support-for-shell-scripts-with-a-spac.patch - Includes patch to fix copying to protocols which don't always report available space (boo#1174169): * 0001-FileSystemFreeSpaceJob-emit-error-if-the-kioslave-di.patch - Too many changes to list here.- Update to 5.71.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.71.0 - Too many changes to list here. - Drop upstream patches: * Fix-service-file-specifying-Run-in-terminal-giving-error.patch * CopyJob-Check-if-destination-dir-is-a-symlink.patch- Add kded as a required package since kio calls org.kde.kded5 via dbus- Add Fix-service-file-specifying-Run-in-terminal-giving-error.patch to fix starting services that use "Run in terminal" (kde#421374) - Add CopyJob-Check-if-destination-dir-is-a-symlink.patch to fix copying files to symlinked folders (kde#421213)- Update to 5.70.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.70.0 - Too many changes since 5.69.0, only listing bugfixes: * [RenameDialog] Add an arrow indicating direction from src to dest (kde#268600) * Make the HTML file template more useful (kde#419935) * kio_trash: Add size, modification, access and create date for trash:/ (kde#413091) * Show previews on encrypted filesystems (kde#411919) * [KPropertiesDialog] Disable changing remote dir icons (kde#205954)- Update to 5.69.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.69.0 - Too many changes since 5.68.0, only listing bugfixes: * FileWidgets: Ignore Return events from KDirOperator (kde#412737) * [KNewFileMenu] Add extension to proposed filename (kde#61669) * [DesktopExecParser] Open {ssh,telnet,rlogin}:// urls with ktelnetservice (kde#418258)- Update to 5.68.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.68.0.php - Too many changes since 5.67.0, only listing bugfixes: * [KFileFilterCombo] Don't add invalid QMimeType to mimes filter (kde#417355) * Fix running konsole on Wayland (kde#408497) * KIO::iconNameForUrl: fix searching for kde protocol icons (kde#417922) * Change "AutoSkip" to "Skip All" (kde#416964) * [KOpenWithDialog] Automatically select the result if the model filter has only one match (kde#400725)- Replace %make_jobs with %cmake_build.- Update to 5.67.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.67.0.php - Too many changes since 5.66.0, only listing bugfixes: * Allow to handle apps with Terminal=True in their desktop file, handle their associated mimetype properly (kde#410506) * Add KIO::DropJobFlag to allow manually showing the menu (kde#415917) * [KOpenWithDialog] Hide collapsible group box when all options inside are hidden (kde#415510) * SlaveBase::dispatchLoop: Fix timeout calculation (kde#392768) * [KDirOperator] Allow renaming files from the context menu (kde#189482)- Update to 5.66.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.66.0.php - Too many changes since 5.65.0, only listing bugfixes: * Adding support for mounting KIOFuse URLs for applications that don't use KIO (kde#398216) * [KUrlNavigator] Add RPM support to krarc: (kde#408082) * KFilePlaceEditDialog: fix crash when editing the Trash place (kde#415676)- Update to 5.65.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.65.0.php - Too many changes since 5.64.0, only listing bugfixes: * [KFileWidget] Avoid calling slotOk right after the url changed (kde#412737) * KRun: don't override user preferred app when opening local *.*html and co. files (kde#399020) * [KPropertiesDialog] provide a way of showing the target of a symlink (kde#413002) * [Remote ioslave] Add Display Name to remote:/ (kde#414345) * Fix HTTP proxy settings (kde#414346) * [DeleteJob] Use a separate worker thread to run actual IO operation (kde#390748) * [KPropertiesDialog] Make creation date string mouse-selectable too (kde#413902)- Update to 5.64.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.64.0.php - Too many changes since 5.63.0, only listing bugfixes: * Treat "application/x-ms-dos-executable" as executable on all platforms (kde#412694) - Drop kio-5.63.0-fix-depth-with-kdav.patch. Merged upstream.- Fix nextcloud calendar content not visible (kde#413316) * kio-5.63.0-fix-depth-with-kdav.patch- Update to 5.63.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.63.0.php - Too many changes since 5.62.1, only listing bugfixes: * Fix crash on exit in kio_file (kde#408797) * [KUrlNavigatorPlacesSelector] Properly identify teardown action (kde#403454) * KCoreDirLister: fix crash when creating new folders from kfilewidget (kde#401916) * [Advanced Permissions] Fix icon names (kde#411915)- Update to 5.62.1 * Fixed interaction with DOS/Windows executables in KRun::runUrl- Update to 5.62.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.62.0.php - Changes since 5.61.0: * [CopyJob] Use resolved URL in copyingDone so undo can rename back using local file (kde#391606) * FileUndoManager: improve debugging facilities * kio_trash: split up copyOrMove, for a better error than "should never happen" * FileUndoManager: clearer assert when forgetting to record * Fix exit and crash in kio_file when put() fails in readData. * autotests: use QVERIFY2 to print the job error if exec() fails * [CopyJob] Fix crash when copying an already existing dir and pressing "Skip" (kde#408350) * [KUrlNavigator] Add MIME types supported by krarc to isCompressedPath (kde#386448) * Added dialog to set execute permission for executable file when trying to run it. * [KPropertiesDialog] Always check mount point being null (kde#411517) * [KRun] Check mime type for isExecutableFile first * Add an icon for the trash root and a proper label * Add support for handling QNAM SSL errors to KSslErrorUiData * Making FileJob behave consistently. * assert slave command finality * [KFilePlacesView] Use asynchronous KIO::FileSystemFreeSpaceJob * rename internal 'kioslave' helper executable to 'kioslave5' (kde#386859) * [KDirOperator] Middle-elide labels that are too long to fit * [KDirOperator] Add follow new directories options * KDirOperator: Only enable "Create New" menu if the selected item is a directory * KIO FTP: Fix file copy hanging when copying to existing file * KIO: port to non-deprecated KWindowSystem::setMainWindow * KRun: fix runtime warning when widget is null * KRun: remove KProcessRunner dependency on QtWidgets * Port KIO::Job documentation to Qt5-style connect syntax * Make file bookmark names consistent * Remove unused includes * Add option to build Qt Designer plugin (BUILD_DESIGNERPLUGIN, default ON) * [KDirOperator] Use more human-readable sort order descriptions * Fix build by removing obsolete qrc file for newly-removed images * [Permissions editor] Port icons to use QIcon::fromTheme() (kde#407662) - Replace foo-devel with cmake(KF5Foo) in build requirements- Update to 5.61.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.61.0.php - Changes since 5.60.0: * Remove explicit use of ECM_KDE_MODULE_DIR, is part of ECM_MODULE_PATH * Use identical internet-services icon. * Stabilize test KFileWidgetTest::testDropFile * Add missing KIOWIDGETS_NO_DEPRECTAED check * Deprecate suggestName * Replace implementation of suggestName with KFileUtils::suggestName * Port internal usage of KIO::suggestName * Fix can't enter directory error on some FTP servers with Turkish locale (kde#409740) * Port from KRun::runService to KRun::runApplication * Fix compiler warnings about initialization order. * Look for protocols in the bin dir too, to fix the autotests- Don't lower minimum Qt version anymore, it requires 5.11 now - Drop conditionals for no longer supported openSUSE versions- Update to 5.60.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.60.0.php - Changes since 5.59.0: * Fix KFileItemTest::testIconNameForUrl test to reflect different icon name * Fix i18n number-of-arguments error in knewfilemenu warning message * [ftp] Fix wrong access time in Ftp::ftpCopyGet() * [CopyJob] Batch reporting processed amount * [CopyJob] Report results after finishing copy (kde#407656) * Move redundant logic in KIO::iconNameForUrl() into KFileItem::iconName() (kde#356045) * Install KFileCustomDialog * [Places panel] Don't show Root by default * Downgrade "Could not change permissions" dialog box to a qWarning * O_PATH is only available on linux. To prevent the compiler from throwing an error due to it's absence fallback to O_RDONLY. * Show feedback inline when creating new files or folders * Auth Support: Drop privileges if target is not owned by root * [copyjob] Only set modification time if the kio-slave provided it (kde#374420) * Cancel privilege operation for read-only target with the current user as owner * Install in new logging directory when we use kf5 5.59.0 * Add KProtocolInfo::defaultMimetype * Always save view settings when switching from one view mode to another * Restore exclusive group for sorting menu items * Dolphin-style view modes in the file dialog (kde#86838) * kio_ftp: improve error handling when copying to FTP fails * kioexec: change the scary debug messages for delayed deletion - Dropped patches, now upstream: * copyjob-Only-set-modification-time-if-the-kio-slave-provided-it.patch- Add upstream patch to fix downloaded files (via http) getting an "invalid" modification time (boo#1104595, kde#374420) * copyjob-Only-set-modification-time-if-the-kio-slave-provided-it.patch- Update to 5.59.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.59.0.php - Changes since 5.58.0: * Manipulate bytes instead of characters * Fix kioslave executables never exiting, when setting KDE_FORK_SLAVES. * Fix desktop link to file or directory (kde#357171) * Test current filter before setting a new one (kde#407642) * [kioslave/file] Add a codec for legacy filenames * Rely upon QSysInfo to retrieve the system details * Add Documents to the default list of Places * KIO: port away from QSslSocket+QFileInfo deprecated API * kioslave: preserve argv[0], to fix applicationDirPath() on non-Linux * KOpenWith: port away from deprecated QModelIndex::child() * autotests: update host after www.davidfaure.fr breakage * Allow to drop one file or one folder on KDirOperator (kde#45154) * Truncate long filname before creating a link (kde#342247) * Remove deprecated method qVariantFromValue->QVariant::fromValue- Update to 5.58.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.58.0.php - Changes since 5.57.0: * [FileWidget] Replace "Filter:" with "File type:" when saving with a limited list of mimetypes (kde#79903) * use actually existing breeze icon for the new file Program.desktop * Reword some text, a couple clean ups, add a separator * autotests: adapt to QUrl behaviour change in Qt 5.12.1 * autotests: adapt to shared-mime-info change * Use regular stat when resolving a symlink * autotests: kfileitemtest: close file before inspecting it * [Properties dialog] Use the string "Free space" instead of "Disk usage" (kde#406630) * Remove TODO * Truncate trailing forward slashes(/) * Fix signed/unsigned warning after statx change * Fill UDSEntry::UDS_CREATION_TIME under linux when glibc >= 2.28 * [KUrlNavigator] Fix URL navigation when exiting archive with krarc and Dolphin (kde#386448) * [KDynamicJobTracker] When kuiserver isn't available, also fall back to widget dialog (kde#379887)- Update to 5.57.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.57.0.php - Changes since 5.56.0: * Too many changes to list here - Dropped patches, now upstream: * Fix-NTFS-hidden-check-for-symlinks.patch- Update to 5.56.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.56.0.php - Changes since 5.55.0: * Port deprecated methods * kioexec: KAboutData::setupCommandLine() already sets help & version * Fix crash in Dolphin when dropping trashed file in trash (kde#378051) * Use correct prefix for static variable * Middle-elide very long filenames in error strings (kde#404232) * Add support for portals in KRun * [KPropertiesDialog] Fix group combobox (kde#403074) * properly attempt to locate the kioslave bin in $libexec AND $libexec/kf5 * Use AuthCore instead of Auth * Add icon name to service providers in .desktop file * Read IKWS search provider icon from desktop file * [PreviewJob] Also pass along that we're the thumbnailer when stat'ing file- Add Fix-NTFS-hidden-check-for-symlinks.patch to avoid hiding symlinks to NTFS mountpoints (kde#402738)- Downgrade the Qt version requirement to build with 5.9- Update to 5.55.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.55.0.php - Changes since 5.54.0: * Improve keyboard controls of the checksum widget * Add helper function to disable redirections (useful for kde-open) * Correct tag * Revert "Refactor SlaveInterface::calcSpeed" (kde#402665) * Revert "Fix elapsed time check" * NetRC: Delete copy constructor and assignment operator * KPasswdServerClient: Delete copy constructor and assignment operator * KSSLSettings: Delete copy constructor and assignment operator * delete copy constructor and assignment operator of some internal classes * Fix elapsed time check * Don't set CMake policy CMP0028 to old. We don't have targets with :: unless they are imported... * [kio] Add ellipsis to search label in Cookies section * [KNewFileMenu] Don't emit fileCreated when creating a directory * Use (and suggest using) the nicer K_PLUGIN_CLASS_WITH_JSON * avoid blocking kio_http_cache_cleaner and ensure exit with session (kde#367575) * Fix failing knewfilemenu test and underlying reason for its failure - Dropped patches, now upstream: * 0002-Revert-Refactor-SlaveInterface-calcSpeed.patch- Update to 5.54.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.54.0.php - Changes since 5.53.0: * Too many changes to list here - Add upstream patch to prevent crashes in KIO (kde#402665) * 0002-Revert-Refactor-SlaveInterface-calcSpeed.patch- Update to 5.53.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.53.0.php - Changes since 5.52.0: * Too many changes to list here- Update to 5.52.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.52.0.php - Changes since 5.51.0: * Too many changes to list here - Dropped patches, now upstream: * 0001-kio_help-Fix-crash-in-QCoreApplication-when-accessin.patch- Add patch to fix kio_help crashing on start: * 0001-kio_help-Fix-crash-in-QCoreApplication-when-accessin.patch- Run spec-cleaner- Update to 5.51.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.51.0.php - Changes since 5.50.0: * Too many changes to list here- Update to 5.50.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.50.0.php - Changes since 5.49.0: * Too many changes to list here - Drop 0001-Revert-Support-NTFS-hidden-files.patch, the problem with the root folder being hidden has been fixed (or rather workarounded) upstream- Update to 5.49.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.49.0.php - Changes since 5.48.0: - Too many changes to list here- Update to 5.48.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.48.0.php - Changes since 5.47.0: * Too many changes to list here - Refreshed patches: * 0001-Revert-Support-NTFS-hidden-files.patch- Update to 5.47.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.47.0.php - Changes since 5.46.0: * Check if destination exists also when pasting binary data (kde#394318) * Auth support: Return the actual length of socket buffer * Auth support: Unify API for file descriptor sharing * Auth support: Create socket file in user's runtime directory * Auth support: Delete socket file after use * Auth support: Move task of cleaning up socket file to FdReceiver * Auth support: In linux don't use abstract socket to share file descriptor * [kcoredirlister] Remove as many url.toString() as possible * KFileItemActions: fallback to default mimetype when selecting only files (kde#393710) * Introduce KFileItemListProperties::isFile() * KPropertiesDialogPlugin can now specify multiple supported protocols using X-KDE-Protocols * Preserve fragment when redirecting from http to https * [KUrlNavigator] Emit tabRequested when path in path selector menu is middle-clicked * Performance: use the new uds implementation * Don't redirect smb:/ to smb:// and then to smb:/// * Allow accepting by double-click in save dialog (kde#267749) * Enable preview by default in the filepicker dialog * Hide file preview when icon is too small * i18n: use plural form again for plugin message * Use a regular dialog rather than a list dialog when trashing or deleting a single file * Make the warning text for deletion operations emphasize its permanency and irreversibility * Revert "Show view mode buttons in the open/save dialog's toolbar"- Don't recommend kio-extras5- Update to 5.46.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.46.0.php - Changes since 5.45.0: * Too many changes to list here - Refreshed patches: * 0001-Revert-Support-NTFS-hidden-files.patch- Add 0001-Revert-Support-NTFS-hidden-files.patch to revert the new support for NTFS hidden files, it caused the mount point itself to be hidden (boo#1091780, kde#392913)- Update to 5.45.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.45.0.php - Changes since 5.44.0: * Too many changes to list here- Update to 5.44.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.44.0.php - Changes since 5.43.0: * Too many changes to list here - Dropped patches, now upstream: * 0001-Dont-stat-etc-localtime-between-read-and-write.patch * 0001-Fix-bug-382437-Regression-in-kdialog-causes-wrong-file-ext.patch- Add patch to fix a problem that made kio copy files too slowly (kde#384561) * 0001-Dont-stat-etc-localtime-between-read-and-write.patch - Add patch to fix kdialog writing files with .bin extension in chrome when downloading files (kde#382437) * 0001-Fix-bug-382437-Regression-in-kdialog-causes-wrong-file-ext.patch- Update to 5.43.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.43.0.php - Changes since 5.42.0: * Too many changes to list here - Dropped patches, now upstream: * 0001-Fix-KFilePreviewGenerator-LayoutBlocker.patch * fix-overlap-of-first-item-in-kfileplacesview.patch- Update to 5.42.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.42.0.php - Changes since 5.41.0: * Too many changes to list here - Add upstream patch fix-overlap-of-first-item-in-kfileplacesview.patch: * Fixes overlapping in items in the places view - Dropped patches, now upstream: * fix-handling-of-KCookieAdvice_AcceptForSession.patch- Add patch to fix layout of icons in the file dialog (kde#352776): * 0001-Fix-KFilePreviewGenerator-LayoutBlocker.patch- Update to 5.41.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.41.0.php - Changes since 5.40.0: * Too many changes to list here - Dropped patches, now upstream: * kio-5.40-fix-directory-creation.patch- Fix error upon directory creation with Dolphin (kde#387073): * Add kio-5.40-fix-directory-creation.patch.- Update to 5.40.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.40.0.php - Changes since 5.39.0: * Fix display of remote:/ in the qfiledialog * Implement support for categories on KfilesPlacesView * HTTP: fix error string for the 207 Multi-Status case * KNewFileMenu: clean up dead code, spotted by Coverity * IKWS: Fix possible infinite loop, spotted by Coverity. * KIO::PreviewJob::defaultPlugins() function * Revert "Add support for sharing file descriptor between file ioslave and it's KAuth helper" * Revert "Add kauth helper to file ioslave" * Revert "Add ability to use the new kauth helper in file ioslave" * Add ability to use the new kauth helper in file ioslave * Add kauth helper to file ioslave * Add support for sharing file descriptor between file ioslave and it's KAuth helper- Add fix-handling-of-KCookieAdvice_AcceptForSession.patch to fix the "Accept For Session" cookie setting that was not properly respected (boo#1049975, kde#386325)- Update to 5.39.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.39.0.php - Changes since 5.38.0: * kioexec: Watch the file when it has finished copying (kde#384500) * Make the string translatable * KFileItemDelegate: Always reserve space for icons (kde#372207) * Show kioslave names in the debug output- Update to 5.38.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.38.0.php - Changes since 5.37.0: * Too many changes to list here - Dropped patches, now upstream: * fix-applying-special-file-attributes.patch * KDesktopPropsPlugin-create-destination-dir.patch * Really-rate-limit-INF_PROCESSED_SIZE-messages.patch- Add Really-rate-limit-INF_PROCESSED_SIZE-messages.patch to not cause high CPU load during file copies (kde#383843, boo#1016920, boo#1051349) - Add KDesktopPropsPlugin-create-destination-dir.patch to fix modifying applications' .desktop files in the "Edit File Type" dialog if the corresponding directory doesn't exist in ~/.local/share/ (boo#1000946)- Add fix-applying-special-file-attributes.patch to fix modifying advanced permissions in the file/folder properties dialog (boo#978935, kde#365795)- Update to 5.37.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.37.0.php - Changes since 5.36.0 : * Fix assert in UrlUtil::firstChildUrl() * Add new method urlSelectionRequested to KUrlNavigator * Revert "Emit a "." UDSEntry when not present, even on empty directories." * KUrlNavigator: expose the KUrlNavigatorButton that received a drop event * Fix build on musl libc by exposing setgroups(2). * Emit a "." UDSEntry when not present, even on empty directories. (kde#382046) * Fix test not found when setting CMAKE_RUNTIME_OUTPUT_DIRECTORY, for some reason. * Stash without asking the user with a Copy/Cancel popup. * Ensure KDirLister updates items whose target URL has changed. (kde#382341) * Fix kdirwatch warning * API dox: use official name "D-Bus" consistently * Make advanced options of "open with" dialog collabsible and hidden by default * Minor: Fix a couple of deprecation warnings- Update to 5.36.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.36.0.php - Changes since 5.35.0: * [KNewFileMenu] Hide "Link To Device" menu if it would be empty * Use KIO::rename instead of KIO::moveAs in setData (kde#380897, kde#380898) * Get the doc dirs with the newly exported function * Fix drop menu position on Wayland * KUrlRequester: Set NOTIFY signal to textChanged() for text property. * [KOpenWithDialog] HTML-escape file name * tests: dropjobtest: register KIO::CopyJob* as metatype * tests: fix krununittest when install prefix has spaces * [FEATURE] Option to build & install QCH file with the public API dox * KCoreDirLister::cachedItemForUrl: don't create the cache if it didn't exist * Use "data" as filename when copying data urls (kde#379093)- Update to 5.35.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.35.0.php - Changes since 5.34.0: * Too many changes to list here - Dropped patches, now upstream: * 0001-Identify-PIE-binaries-application-x-sharedlib-as-exe.patch- Add patch to allow running PIE enabled binaries (kde#350018): * 0001-Identify-PIE-binaries-application-x-sharedlib-as-exe.patch- Update to 5.34.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.34.0.php - Changes since 5.33.0: * Fix quoting of preprocessor-definition. * KDirSortFilterProxyModel: bring back natural sorting (kde#343452) * Fill UDS_CREATION_TIME with the value of st_birthtime on FreeBSD * http slave: send error page after authorization failure (kde#373323) * kioexec: delegate upload to a kded module (kde#252026, kde#370532) * Fix KDirlister Gui Test setting URL scheme twice * Delete kiod modules on exit * Don't apply the workaround before Qt 5.8.0 * Generate a moc_predefs.h file for KIOCore (kde#371721) * kioexec: fix support for --suggestedfilename - Remove patches, now upstream: * enable-natural-sorting-in-KDirSortFilterProxyModel.patch - Use %find_lang --with-man --all-name - Use %kf5_find_htmldocs- Update to 5.33.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.33.0.php - Changes since 5.32.0: * make remote file:// URL redirect to smb:// work again * Upgrade ECM and KF5 version requirements for 5.33.0 release. * keep query encoding when HTTP Proxy is used * Fix minor typos * User messages cleanup (and de-emphasize Konqueror) * Updated user agents (Firefox 52 ESR, Chromium 57) * Added plugin actions * Simple patch * autotest: comment why the SSE-disabling thing doesn't work (QTBUG-47566) * Handle/truncate url display string assigned to job description. Prevents large data: urls from being included in UI notifications. * Restore Cancel button shortcut * Upgrade KF5 version to 5.33.0. * Add KFileWidget::setSelectedUrl() * Fix KUrlRequester save mode by adding setAcceptMode REVIEW: 129986 * With this change it is now possible to list multiple paths as defined via the command line.- Add enable-natural-sorting-in-KDirSortFilterProxyModel.patch to use natural sorting by default in the KDE file dialog and gwenview, configurable via the "NaturalSorting" option in kdeglobals (boo#1033668, kde#343452)- Drop sanitize-url-for-proxy.patch, merged upstream- Update to 5.32.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.32.0.php - Changes since 5.31.0: * Too many changes to list here * Commit translations from l10n-kf5 * Cookies KCM: disable "delete" button when there is no current item * Use the new shared library exported by KDocTools * Upgrade ECM and KF5 version requirements for 5.32.0 release. * Sanitize URLs before passing them to FindProxyForURL * make sure the cancel action is last * kio_help: use doOutputBuffer and simplify unicodeError * rename support: emit proper URL in FileRenamed * fix rename support: keep trashId rather than expecting it as input * remote: remove unused include * remote: remove redundant check * remote: rename kded module to allow co-installability with plasma-workspace <= 5.9 * remote: use QUrl::fromLocalFile() * remote: just check if file exists * remote: use QDir::mkpath() to create the remoteview folder * remote: drop Messages.sh * remote: use same debug category as other slaves * remote: use json protocol * remote: don't redefine TRANSLATION_DOMAIN * remote: slots -> Q_SLOTS * Import remote ioslave from plasma-workspace * Fix TODO. We depend on Qt 5.3 by now * kio_trash: implement renaming of toplevel files and dirs * [PreviewJob] Remove maximum size for local files by default * allow to add application actions on an open menu * Port another use of QDateTime to QElapsedTimer. With proper / 1000 this time :) * Fixup previous commit to slave.cpp, divide by 1000 was missing. * [autotest] KTcpSocketTest was racy and leaky => simplify, fix. * Port from QDateTime::currentDateTime() to QElapsedTimer * Upgrade KF5 version to 5.32.0. * Fix double export in already-exported class * deprecate DrawFrame, as discussed in https://git.reviewboard.kde.org/r/129921/- Add patch to fix security issue with proxy configuration (boo#1027520) * sanitize-url-for-proxy.patch- Update to 5.31.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.31.0.php- Update to 5.30.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.30.0.php- Update to 5.29.0 * Ported to categorized logging * Fix compilation against WinXP SDK * Allow uppercase checksums matching in Checksums tab (kde#372518) * Never stretch the last (=date) column in the file dialog (kde#312747) * Import and update kcontrol docbooks for code in kio from kde-runtime master * [OS X] make KDE's trash use the OS X trash * SlaveBase: add documentation about event loops and notifications and kded modules * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.29.0.php- Update to 5.28.0 * Fix HTTP date format sent by kio_http to always use the C locale (kde#372005) * KACL: fix memory leaks detected by ASAN * Fix memory leaks in KIO::Scheduler, detected by ASAN * Removed duplicate clear button (kde#369377) * Fix editing autostart entries when /usr/local/share/applications doesn't exist (kde#371194) * [KOpenWithDialog] Hide TreeView header * Sanitize the symlink name buffer size (kde#369275) * Properly finish DropJobs when triggered is not emitted (kde#363936) * ClipboardUpdater: fix another crash on Wayland (kde#359883) * ClipboardUpdater: fix crash on Wayland (kde#370520) * Support non integer scale factors in KFileDelegate (kde#366451) * kntlm: Distinguish between NULL and empty domain * Don't show overwrite dialog if file name is empty * kioexec: use friendly filenames * Fix focus ownership if url is changed before showing the widget * Major performance improvement when turning previews off in the file dialog (kde#346403) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.28.0.php- Update to 5.27.0 * Fix KIO slaves using only tls1.0 * Fix ABI break in kio * KFileItemActions: add addPluginActionsTo(QMenu *) * Show copy buttons only after checksum has been calculated * Add missing feedback when computing a checksum (kde#368520) * Fix KFileItem::overlays returning empty string values * Fix launching terminal .desktop files with konsole * Classify nfs4 mounts as probablySlow, like nfs/cifs/.. * KNewFileMenu: show New Folder action shortcut (kde#366075) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.27.0.php - Drop upstreamed 0001-Fix-kio-using-only-tls1.0.patch and Fix-launching-terminal-desktop-files-with-konsole.patch- Add 0001-Fix-kio-using-only-tls1.0.patch- Added Fix-launching-terminal-desktop-files-with-konsole.patch (kde#368949, boo#1003125)- Update to 5.26.0 * KPropertiesDialog: remove warning note from docu, the bug is gone * [test program] resolve relative paths using QUrl::fromUserInput * KUrlRequester: fix error box when selecting a file and reopening the file dialog * Provide a fallback if slaves don't list the . entry (kde#366795) * Fix creating symlink over "desktop" protocol * KNewFileMenu: when creating symlinks use KIO::linkAs instead of KIO::link * KFileWidget: fix double '/' in path * KUrlRequester: use static connect() syntax, was inconsistent * KUrlRequester: pass window() as parent for the QFileDialog * Avoid calling connect(null, .....) from KUrlComboRequester * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.26.0.php- Remove workaround to install "Create New" templates as actual files, the issues with using the embedded resource are fixed in 5.25.0- Update to 5.25.0 * Qt >= 5.5 is now required * Fix KIO::linkAs() to work as advertised, i.e. fail if dest already exists * Fix KIO::put("file:///path") to respect the umask (kde#359581) * Fix KIO::pasteActionText for null dest item and for empty URL * Add support for undoing symlink creation * GUI option to configure global MarkPartial for KIO slaves * Fix MaxCacheSize limited to 99 KiB * Add clipboard buttons to checksums tab * KNewFileMenu: fix copying template file from embedded resource (kde#359581) * KNewFileMenu: Fix creating link to application (kde#363673) * KNewFileMenu: Fix suggestion of new filename when file already exist in desktop * KNewFileMenu: ensure fileCreated() is emitted for app desktop files too * KNewFileMenu: fix creating symlinks with a relative target * KPropertiesDialog: simplify button box usage, fix behavior on Esc * KProtocolInfo: refill cache to find newly installed protocols * KIO::CopyJob: port to qCDebug (with its own area, since this can be quite verbose) * KPropertiesDialog: add Checksums tab * Clean url's path before initializing KUrlNavigator * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.25.0.php- Update to 5.24.0 * KIO: add SlaveBase::openPasswordDialogV2 for better error checking, please port your kioslaves to it * Fix KUrlRequester opening file dialog in wrong directory (kde#364719) * Fix unsafe KDirModelDirNode* casts * Add cmake option KIO_FORK_SLAVES to set default value * ShortUri filter: fix filtering of mailto:user@host * Add OpenFileManagerWindowJob to highlight file within a folder * KRun: add runApplication method * Add soundcloud search provider * Fix an alignment issue with the OS X native "macintosh" style * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.24.0.php- Update to 5.23.0 * Give clearer error message when KRun(URL) is given a URL without scheme (kde#363337) * Add KProtocolInfo::archiveMimetypes() * Use selected icon mode in file open dialog sidebar * kshorturifilter: fix regression with mailto: not prepended when no mailer is installed * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.23.0.php- Update to 5.22.0 (boo#980066) * kurlnavigatortoolbutton.cpp - use buttonWidth in paintEvent() * New file menu: filter out duplicates (e.g. between .qrc and system files) (kde#355390) * Fix error message on startup of the cookies KCM * Remove kmailservice5, it can only do harm at this point (kde#354151) * Fix KFileItem::refresh() for symlinks. The wrong size, filetype and permissions were being set * Fix regression in KFileItem: refresh() would lose the file type, so a dir became a file (kde#353195) * Set text on QCheckbox widget rather than using a separate label (kde#245580) * Don't enable acl permissions widget if we don't own the file (kde#245580) * Fix double-slash in KUriFilter results when a name filter is set * KUrlRequester: add signal textEdited (forwarded from QLineEdit) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.22.0.php- Update to 5.21.0 (boo#974793) * FavIconsCache: sync after write, so other apps see it, and to avoid crash on destruction * Fix many threading issues in KUrlCompletion * Fix crash in rename dialog (360488) * KOpenWithDialog: improve window title and description text (359233) * Allow for better cross-platform deployment of io slaves by bundling protocol info in plugin meta data * Upgrade Qt version requirement to 5.4.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.21.0.php - Drop upstreamed 0001-Fix-crash-in-rename-dialog.patch- Added 0001-Fix-crash-in-rename-dialog.patch (kde#360488)- Update to 5.20.0 (boo#970856) * Fix KIO app-slave connection breaking if appName contains a '/' (kde#357499) * Try multiple authentication methods in case of failures * help: fix mimeType() on get() * KOpenWithDialog: show mimetype name and comment in "Remember" checkbox text (kde#110146) * A series of changes to avoid a directory relist after a file rename in more cases (kde#359596) * http: rename m_iError to m_kioError * kio_http: read and discard body after a 404 with errorPage=false * kio_http: fix mimetype determination when URL ends with '/' * FavIconRequestJob: add accessor hostUrl() so that konqueror can find out what the job was for, in the slot * FavIconRequestJob: fix job hanging when aborting due to favicon too big * FavIconRequestJob: fix errorString(), it only had the URL * KIO::RenameDialog: restore preview support, add date and size labels (kde#356278) * KIO::RenameDialog: refactor duplicated code * Fix wrong path-to-QUrl conversions * Use kf5.kio in the category name to match other categories * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.20.0.php- Install "Create New" templates to %{_kf5_sharedir}/templates/ as a workaround until kde#356198 is fixed (boo#963680)- Update to 5.19.0 (boo#967668) * New class FavIconRequestJob in new lib KIOGui, for favicons retrieval * Fix KDirListerCache crash with two listers for an empty dir in the cache (kde#278431) * Make Windows implementation of KIO::stat for file:/ protocol error out if the file doesn't exist * Don't assume that files in read-only dir can't be deleted on Windows * Fix .pri file for KIOWidgets: it depends on KIOCore, not on itself * Repair kcookiejar autoload, the values got swapped in 6db255388532a4 * Make kcookiejar accessible under the dbus service name org.kde.kcookiejar5 * kssld: install DBus service file for org.kde.kssld5 * Provide a DBus service file for org.kde.kpasswdserver * [kio_ftp] fix display of file/directory modification time/date (boo#960500, kde#354597) * [kio_help] fix garbage sent when serving static files * [kio_http] Try NTLMv2 authentication if the server denies NTLMv1 * [kio_http] fix porting bugs which broke caching * [kio_http] Fix NTLMv2 stage 3 response creation * [kio_http] fix waiting until the cache cleaner listens to the socket * kio_http_cache_cleaner: don't exit on startup if cache dir doesn't exist yet * Change DBus name of kio_http_cache_cleaner so it doesn't exit if the kde4 one is running * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.19.0.php - Drop upstreamed patches: fix-kcookiejar-autoload.patch and kio_ftp-fix-display-of-modification-time-date.patch- Added fix-kcookiejar-autoload.patch to fix the swapped values for the autoload.- Added kio_ftp-fix-display-of-modification-time-date.patch: fixes display of file/directory modification time in kio_ftp (boo#960500, kde#354597)- Update to 5.18.0 * Fix kiod for Qt 5.6's threaded dbus: messageFilter must wait until the module is loaded before returning * Change the error code when pasting/moving into a subdirectory * Fix emptyTrash blocked issue * Fix wrong button in KUrlNavigator for remote URLs * KUrlComboBox: fix returning an absolute path from urls() * kiod: disable session management * Add autocompletion for '.' input which offers all hidden files/folders* (kde#354981) * ktelnetservice: fix off by one in argc check * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.18.0.php- Update to 5.17.0 * Cookie dialogue: make it work as intended * Fix filename suggestion changing to something random when changing save-as mimetype. * Register DBus name for kioexec (kde#353037) * Update KProtocolManager after configuration change. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.17.0.php - Drop upstreamed register-dbus-name-for-kioexec.patch- Added register-dbus-name-for-kioexec.patch: prevent klauncher from freezing and displaying an error message when opening documents (boo#924764, kde#353037)- Update to 5.16.0 (boo#955067) * Save proxy url with correct scheme * Ship the "new file templates" in the kiofilewidgets library using a .qrc (kde#353642) * Properly handle middle click in navigatormenu * Make kio_http_cache_cleaner deployable in application installer/bundles * KOpenWithDialog: Fix creating desktop file with empty mimetype * Read protocol info from plugin metadata * Allow local kioslave deployment * Add a .protocol to JSON converted * Fix double-emit of result and missing warning when listing hits an inaccessible folder (kde#333436) * Preserve relative link targets when copying symlinks. (kde#352927) * Using suitable icons for default folders in the user home (kde#352498) * Add an interface which allow plugin to show custom overlay icons * Make KNotifications dep in KIO (kpac) optional * Make doctools + wallet optional * Avoid kio crashes if no dbus server is running * Add KUriFilterSearchProviderActions, to show a list of actions for searching some text using web shortcuts * Move the entries for the "Create New" menu from kde-baseapps/lib/konq to kio (kde#349654) * Move konqpopupmenuplugin.desktop from kde-baseapps to kio (kde#350769) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.16.0.php - Drop 0001-Move-konqpopupmenuplugin.desktop-from-kde-baseapps-t.patch and 0001-Move-the-entries-for-the-Create-New-menu-from-kde-ba.patch, upstreamed- Update to 5.15.0 * KFileWidget: parent argument should default to 0 like in all widgets. * Make sure the size of the byte array we just dumped into the struct is big enough before calculating the targetInfo, otherwise we're accessing memory that doesn't belong to us * Fix Qurl usage when calling QFileDialog::getExistingDirectory() * Refresh Solid's device list before querying in kio_trash * Allow trash: in addition to trash:/ as url for listDir (calls listRoot) (kde#353181) * KProtocolManager: fix deadlock when using EnvVarProxy. (kde#350890) * Don't try to find X11 on WIN32 * KBuildSycocaProgressDialog: use Qt's builtin busy indicator. (kde#158672) * KBuildSycocaProgressDialog: run kbuildsycoca5 with QProcess. * KPropertiesDialog: fix for ~/.local being a symlink, compare canonical paths * Add support for network shares in kio_trash (kde#177023) * Connect to the signals of QDialogButtonBox, not QDialog (kde#352770) * Cookies KCM: update DBus names for kded5 * Use JSON files directly instead of kcoreaddons_desktop_to_json() * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.15.0.php- Added 0001-Move-konqpopupmenuplugin.desktop-from-kde-baseapps-t.patch (kde#350769) and 0001-Move-the-entries-for-the-Create-New-menu-from-kde-ba.patch (kde#349654)- Update to 5.14.0 * Use Q_OS_WIN instead of Q_OS_WINDOWS * Make KDE_FORK_SLAVES work under Windows * Disable installation of desktop file for ProxyScout kded module * Provide deterministic sort order for KDirSortFilterProxyModelPrivate::compare * Show custom folder icons again (kde#350612) * Move kpasswdserver from kded to kiod * Fix porting bugs in kpasswdserver * Remove legacy code for talking very very old versions of kpasswdserver. * KDirListerTest: use QTRY_COMPARE on both statements, to fix race showed by CI * KFilePlacesModel: implement old TODO about using trashrc instead of a full-blown KDirLister. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.14.0.php - Drop show-custom-folder-icons-sgain.patch, merged upstream- Added show-custom-folder-icons-sgain.patch (kde#350612)- Update to 5.13.0 * The Qt version requirement has been bumped from 5.2 to 5.3 * Debug output has been ported to categorized output, for less noise by default * Docbook documentation has been reviewed and updated * Kill unneeded QUrl wrappers * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.13.0.php- Update to 5.12.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.12.0.php- Update to 5.11.0 * Do not try to complete users and assert when prepend is non-empty. (kde#346920) * Use KPluginLoader::factory() when loading KIO::DndPopupMenuPlugin * Fix deadlock when using network proxies (kde#346214) * Fixed KIO::suggestName to preserve file extensions * Kick off kbuildsycoca4 when updating sycoca5. * KFileWidget: Don't accept files in directory only mode * KIO::AccessManager: Make it possible to treat sequential QIODevice asynchronously * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.11.0.php- Update to 5.10.0 * Added KPropertiesDialog::KPropertiesDialog(urls) and KPropertiesDialog::showDialog(urls). * Asynchronous QIODevice-based data fetch for KIO::storedPut and KIO::AccessManager::put. * Fix conditions with QFile::rename return value (kde#343329) * Fixed KIO::suggestName to suggest better names (kde#341773) * kioexec: Fixed path for writeable location for kurl (kde#343329) * Store bookmarks only in user-places.xbel (kde#345174) * Duplicate RecentDocuments entry if two different files have the same name * Better error message if a single file is too large for the trash (kde#332692) * Fix KDirLister crash upon redirection when the slot calls openURL * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.10.0.php- Update to 5.9.0 * Enable KPropertiesDialog to show free space information of remote file systems as well (e.g. smb) * Fix KUrlNavigator with high DPI pixmaps * Make KFileItemDelegate handle non default devicePixelRatio in animations * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.9.0.php - Split the core modules/daemons/libraries into core subpackage; based on upstream KIOCORE_ONLY build option, which only concerns the buildsystem, not the code (i.e. no ifdefs) - Add kio_help-fallback-to-kde4-docs.patch: allow kio_help to see into kde4 documentation- Add missing requires to devel subpackage: kcoreaddons-devel, kconfig-devel and kitemviews-devel - Drop unneeded kcrash-devel BuildRequires- Update to 5.8.0 * Deprecate UDSEntry::listFields and add the UDSEntry::fields method which returns a QVector without costly conversion. * Sync bookmarkmanager only if change was by this process (kde#343735) * Fix startup of kssld5 dbus service * Implement quota-used-bytes and quota-available-bytes from RFC 4331 to enable free space information in http ioslave. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.8.0.php - Drop 0001-sync-bookmarkmanager-only-if-change-was-by-process.patch, merged upstream- Update to 5.7.0 * Fixed crash in jobs when linking to KIOWidgets but only using a QCoreApplication * Fixed editing web shortcuts * Added option KIOCORE_ONLY, to compile only KIOCore and its helper programs, but not KIOWidgets or KIOFileWidgets, thus reducing greatly the necessary dependencies * Added class KFileCopyToMenu, which adds Copy To / Move To" to popupmenus * SSL-enabled protocols: added support for TLSv1.1 and TLSv1.2 protocols, remove SSLv3 * Fixed negotiatedSslVersion and negotiatedSslVersionName to return the actual negotiated protocol * Apply the entered URL to the view when clicking the button that switches the URL navigator back to breadcrumb mode * Fixed two progress bars/dialogs appearing for copy/move jobs * KIO now uses its own daemon, kiod, for out-of-process services previously running in kded, in order to reduce dependencies; currently only replaces kssld * Fixed "Could not write to " error when kioexec is triggered * Fixed "QFileInfo::absolutePath: Constructed with empty filename" warnings when using KFilePlacesModel * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.7.0.php - Added 0001-sync-bookmarkmanager-only-if-change-was-by-process.patch, kde#343735- Update to 5.6.0 * Add support for .hidden files, for users to hide some files from views. (kde#246260) * New method KRun::runService, like KRun::run but returns the PID of the newly started process. * kioexec: fixed many porting bugs, to make it work again * KRun::run: fixed porting bug, to make it work again in the case where KProcess is used directly * KRun: make klauncher runtime dependency optional * Fix compilation on MSVC * Performance: decrease memory consumption of UDSEntry * Actions in popupmenus: in case of multiple mimetypes selected, services that support all mimetypes are now added to the menu. * New job: KIO::DropJob *KIO::drop(QDropEvent* ev, QUrl destUrl). Replaces KonqOperations::doDrop. * Restart directory watcher after a failed delete operation * Fix false warning about X-KDE-Protocols unused in desktop files without that field. * Merge various settings modules (KCMs) related to kio, into the kio framework. * When copying/moving out the trash, make the files writable. * KIO::file_move now does the chmod on the destination file before emitting result. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.6.0.php- Update to 5.5.0 * Fix Size columns being empty in the KFileWidget detailed views * Do not drop ASN passed to KRun when executing desktop files * Fix passing of DESKTOP_STARTUP_ID to child process in kioexec * Fix compilation with Qt 5.2, which also fixes a race condition * KFileItem: cleanup overlay icon usage * Implement back/forward side mouse buttons to navigate in the history * Allow user to cancel out of the certificate accept duration dialog box. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.5.0.php - Added pkgconfig(Qt5X11Extras) BuildRequires- Update to 5.4.0 * New job KIO::mkpath() * New job KIO::PasteJob, handles pasting+dropping URLs and data; KIO::paste replaces KIO::pasteClipboard * New function KIO::pasteActionText, to handle the paste action * When clicking on a script or desktop file in a file manager, let the user choose between executing and vieweing as text * KUrlRequester: fixing handling of start directory * Offer also overwrite option when copying multiple files and there is a conflict (regression compared to kdelibs4) * KDirLister: do not kill+restart running update jobs. * KDirLister: don't emit refreshItems for items that haven't changed. * Prevent incorrect disk full error messages on mounts where we cannot determine the amount of free space. * Fix running the file type editor * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.4.0.php - Added kinit Recommendss390zp24 1629996683  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%5.76.05.76.0-bp153.3.2.15.76.0-bp153.3.2.1   protocoltojsonKF5KIOCoreKACLKCoreDirListerKDirNotifyKDiskFreeSpaceInfoKFileItemKFileItemListPropertiesKIOAuthInfoBatchRenameJobChmodJobConnectionServerCopyJobDavJobDeleteJobDesktopExecParserDirectorySizeJobEmptyTrashJobFileCopyJobFileJobFileSystemFreeSpaceJobForwardingSlaveBaseGlobalHostInfoIdleSlaveJobJobTrackerJobUiDelegateExtensionJobUiDelegateFactoryListJobMetaDataMimetypeJobMkdirJobMkpathJobMultiGetJobNameFinderJobRestoreJobSchedulerSimpleJobSlaveSlaveBaseSlaveConfigSlaveInterfaceSpecialJobStatJobStoredTransferJobTCPSlaveBaseTransferJobUDSEntryKMountPointKNFSShareKPasswdServerClientKProtocolInfoKProtocolManagerKRecentDocumentKRemoteEncodingKSSLSettingsKSambaShareKSambaShareDataKSslCertificateManagerKSslErrorUiDataKTcpSocketKUrlAuthorizedkacl.hkcoredirlister.hkdirnotify.hkdiskfreespaceinfo.hkfileitem.hkfileitemlistproperties.hkioauthinfo.hbatchrenamejob.hchmodjob.hconnectionserver.hcopyjob.hdavjob.hdeletejob.hdesktopexecparser.hdirectorysizejob.hemptytrashjob.hfilecopyjob.hfilejob.hfilesystemfreespacejob.hforwardingslavebase.hglobal.hhostinfo.hhttp_slave_defaults.hidleslave.hioslave_defaults.hjob.hjob_base.hjobclasses.hjobtracker.hjobuidelegateextension.hjobuidelegatefactory.hlistjob.hmetadata.hmimetypejob.hmkdirjob.hmkpathjob.hmultigetjob.hnamefinderjob.hrestorejob.hscheduler.hsimplejob.hslave.hslavebase.hslaveconfig.hslaveinterface.hspecialjob.hstatjob.hstoredtransferjob.htcpslavebase.htransferjob.hudsentry.hkiocore_export.hkmountpoint.hknfsshare.hkpasswdserverclient.hkprotocolinfo.hkprotocolmanager.hkrecentdocument.hkremoteencoding.hksambashare.hksambasharedata.hksslcertificatemanager.hksslcertificatemanager_p.hksslerroruidata.hksslsettings.hktcpsocket.hkurlauthorized.hKIOFileWidgetsKAbstractViewAdapterKDirOperatorKDirSortFilterProxyModelKEncodingFileDialogKFileCopyToMenuKFileCustomDialogKFileFilterComboKFilePlaceEditDialogKFilePlacesModelKFilePlacesViewKFilePreviewGeneratorKFileWidgetKImageFilePreviewKNameAndUrlInputDialogKNewFileMenuKPreviewWidgetBaseKRecentDirsKStatusBarOfflineIndicatorKUrlNavigatorkabstractviewadapter.hkdiroperator.hkdirsortfilterproxymodel.hkencodingfiledialog.hkfilecopytomenu.hkfilecustomdialog.hkfilefiltercombo.hkfileplaceeditdialog.hkfileplacesmodel.hkfileplacesview.hkfilepreviewgenerator.hkfilewidget.hkimagefilepreview.hkiofilewidgets_export.hknameandurlinputdialog.hknewfilemenu.hkpreviewwidgetbase.hkrecentdirs.hkstatusbarofflineindicator.hkurlnavigator.hKIOGuiKIOApplicationLauncherJobCommandLauncherJobFavIconRequestJobOpenUrlJobkioapplicationlauncherjob.hcommandlauncherjob.hfaviconrequestjob.hopenurljob.hkiogui_export.hKIOWidgetsKAbstractFileItemActionPluginKAutoMountKBuildSycocaProgressDialogKDesktopFileActionsKDirListerKDirModelKFileKFileItemActionsKFileItemDelegateKIOAccessManagerDndPopupMenuPluginDropJobFileUndoManagerJobUiDelegateKUriFilterSearchProviderActionsOpenFileManagerWindowJobPastePasteJobPixmapLoaderPreviewJobRenameDialogRenameFileDialogSkipDialogSslUiThumbCreatorThumbSequenceCreatorKOpenWithDialogKOverlayIconPluginKPropertiesDialogKRunKShellCompletionKSslCertificateBoxKSslInfoDialogKUriFilterKUrlComboBoxKUrlCompletionKUrlPixmapProviderKUrlRequesterKUrlRequesterDialogkabstractfileitemactionplugin.hkautomount.hkbuildsycocaprogressdialog.hkdesktopfileactions.hkdirlister.hkdirmodel.hkfile.hkfileitemactions.hkfileitemdelegate.hkioaccessmanager.hdndpopupmenuplugin.hdropjob.hfileundomanager.hjobuidelegate.hkurifiltersearchprovideractions.hopenfilemanagerwindowjob.hpaste.hpastejob.hpixmaploader.hpreviewjob.hrenamedialog.hrenamefiledialog.hskipdialog.hsslui.hthumbcreator.hthumbsequencecreator.hkiowidgets_export.hkopenwithdialog.hkoverlayiconplugin.hkpropertiesdialog.hkrun.hkshellcompletion.hksslcertificatebox.hksslinfodialog.hkurifilter.hkurlcombobox.hkurlcompletion.hkurlpixmapprovider.hkurlrequester.hkurlrequesterdialog.hkiokntlm.hkntlm_export.hkio_version.hKF5KIOKF5KIOConfig.cmakeKF5KIOConfigVersion.cmakeKF5KIOTargets-none.cmakeKF5KIOTargets.cmakelibKF5KIOCore.solibKF5KIOFileWidgets.solibKF5KIOGui.solibKF5KIONTLM.solibKF5KIOWidgets.soqt_KIOCore.priqt_KIOFileWidgets.priqt_KIOGui.priqt_KIOWidgets.priqt_KNTLM.pridesignerkio5widgets.sokf5_org.kde.KCookieServer.xmlkf5_org.kde.KDirNotify.xmlkf5_org.kde.KPasswdServer.xmlkf5_org.kde.KSlaveLauncher.xmlkf5_org.kde.kio.FileUndoManager.xml/usr/bin//usr/include//usr/include/KF5//usr/include/KF5/KIOCore//usr/include/KF5/KIOCore/KIO//usr/include/KF5/KIOCore/kio//usr/include/KF5/KIOFileWidgets//usr/include/KF5/KIOGui//usr/include/KF5/KIOGui/KIO//usr/include/KF5/KIOGui/kio//usr/include/KF5/KIOWidgets//usr/include/KF5/KIOWidgets/KIO//usr/include/KF5/KIOWidgets/kio//usr/include/KF5/kio//usr/lib64/cmake//usr/lib64/cmake/KF5KIO//usr/lib64//usr/lib64//usr/lib64//usr/lib64//usr/lib64//usr/lib64/qt5/mkspecs/modules//usr/lib64/qt5/plugins//usr/lib64/qt5/plugins/designer//usr/share/dbus-1/interfaces/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:16873/openSUSE_Backports_SLE-15-SP3_Update/a60452f4ca44a4593478cb87e7774c07-kio.openSUSE_Backports_SLE-15-SP3_Updatedrpmxz5s390x-suse-linuxELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, interpreter /lib/ld64.so.1, BuildID[sha1]=1e51493911ca23e9ba1cd9f34a07b48817d83c48, for GNU/Linux 3.2.0, strippeddirectoryC source, ASCII textC++ source, ASCII textC++ source, UTF-8 Unicode textASCII textELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=6864511764de08a49f1b68132aaaae32e019c389, strippedexported SGML document, ASCII text RRRRRRPRRRRRRRRRRRRpn%utf-8759d722691eaf40c37e1d220918b77b51fa77ad1e0c517b76fd7c56ae82b1a79? 7zXZ !t/  Z]"k%w MkG`To = M]>t.NPpX!ŲވP;'fF]sXGqXjպ'5_N۪X92kA+a, H7Iq],ݕyYۆWsbN:Ǖ|_~ H.Drd `)`cniܳbo%Lt|`+,EB/M{-Rd7Ԋ;.IE8[pQC,r^:'U:&To i .JL:TzJv׬Ϯ mɞnڻfamhX3gۊ ȻQ %¤ 4o< f8U qZlX>,p^U_YKu{b~񧵶&-x&Z｡Ck9:8 !ŵd= f\㺂BqWn^4s {}&]{Yv,:J(|վUaaD s{?.h1 ޢq8lr4V+YZqKk~[>V6:s)P̻G͟9UqJ&׉̒Rus@*Ʒ% ˠN52 2ݏ=I 0+(/A?%8RS4LjDW%z/8K^Jp?h$*>S"~NRqI𵒊8zoe3ɡgU0 SQrEh=*F`Kda!b+t22F2y~10Q$ߏ[.Z@7Qm&HAĞ4{?4'Ν__eM2?)ȿ^[ üX>\Cػ4 d  DY>#5_c-BaJv.3D^I&hQVNj*!VX Ѷ)&kSJ6ek = 'lnd[19pūk=<33Ug++1à:]*(pkR(TjX\CNB+ك8zMRU鐫Mvt~9\:5q̏.d yzwsJZv]G\D0p'(n[@Fne D({ef^(InfX|smm [o%٥=9+rrxV6tE0}fxfj;dV\5坪q|vL RCYp}v[?^a{m*{L#b}1僪)p<+rT,S;7oJrA Jk6׺ܡے|AmCV4t62]ř̆S'( #ЫAN!o8[ bgkVg36mJr9/ .0~A'^WxTf!Aj+sVˮ:kDw:"jJ`4ҝ9A,}KLqtVxolVq-bŹ2ط/ xo5αQ1 ʻs7tZC5Hn+gWCwQ:E ChfC鿵% 'YKDY_rS& bBR-ҌqBYAoz#$*ڈ8_tTq atPf emk<яp[v~"Δ6٥V Lssԥ;fē~W#njJÙ v:u⒅nnDKnx&2i(1uOD>$N bvzo)1"F F[L(?|".7 'S!|1A0Oi O?!O9-J~h어T"$Y$feƍs IJz3W fsӧY q_:/ߺm:+%n j59.2>Ìa1ojz?Y*Bwzpm;>/s :{Ҥ7ұ=Yv]CjxW ۥ>Vgyf|Jl(d\?Ȫԇc:<Y)cۏ@VC7oTT Jh9 ,pG) :Tc}d FeJ@Fxܻf.J]*=GxESic7k^ʲp}|Z(=o/Ҹi1aݳ<o>8hkצU}kF v(@W  YZ