gvim-8.0.1568-lp150.4.3.1<>,J\d/=„<:jn~ՌzA&﹌Kx1PM-*R G%]B wkDZ~$$}>h>B _uD\ߜΛ^ 2:Ikƀ OMHC kXv|4ƣƥBM;WG[.v`00N8+, /MZyt3l Om)A۞Q+__l߫zAEӢńMuPHo?nd  )8<DH[dh h  8   |  - --pty(}89:>c@cBcFcGdHdxIdXdYe`Ze[e\f]f|^gS bhciPdieifiliuivjd wlxm`ym3znnnnnCgvim8.0.1568lp150.4.3.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.\dlamb563openSUSE Leap 15.0openSUSEVimhttp://bugs.opensuse.orgProductivity/Text/Editorshttp://www.vim.org/linuxx86_64/usr/sbin/update-alternatives --install /usr/bin/vim vim /usr/bin/gvim 30if [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fi2rs( C&F,A큤\d\d:\d:\d:\d:\d:\d:\d:\d:\d=\d:\d:\d:\d:\d:\d\d:Z\d:\d:\d:\d:\d:\d:\d:\d:a934e7061c6ac031441022666a6b47007aa717ca9a449cff13b1525eba02a160761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820182d005a09900e1a511d3dea16832b4af880a9f2f2013d4782618f2eb3bd48103de94881aa6d4884e3a9a05faca078a2abb5ff20e5d95a25eb629bade54880a3e08795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0bd203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa097f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f22b498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vim@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-8.0.1568-lp150.4.3.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(x86-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data8.0.1568-lp150.4.3.13.0.4-14.6.0-14.0-15.2-18.0.1568-lp150.4.3.1gvim8.04.14.1\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@Ismail Dönmez stefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedlamb56 1560241396 8.0.1568-lp150.4.3.18.0.1568-lp150.4.3.18.0.1568-lp150.4.3.18.0.1568-lp150.4.3.18.0.1568-lp150.4.3.18.0.1568-lp150.4.3.18.0.1568-lp150.4.3.1 vimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:10380/openSUSE_Leap_15.0_Update/6403267c6c24812db77897519dade1a5-vim.openSUSE_Leap_15.0_Updatedrpmxz5x86_64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-8.0.1568-lp150.4.3.1.x86_64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/l, for GNU/Linux 3.2.0, BuildID[sha1]=2ed84682c4990a2e8993eb4df77e1e10137746e9, strippeddirectoryPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image""RR R%RR#R RRR RR RRRRR RRRRRRRRRRRR$RRRR!R"R PPP P PP PPPPPPPPPP P M]^ȧHL "utf-8080619bede77ba928f38498e1b422c4f1f599d6c43a417246bd00935385b8fc8?7zXZ !t/ ]"k%j`& y0x4Nsq8r8t]},߽dݍqZJ#d-Ā] "#im!h&\Y 1䄼@m.8TuTxS4qryg|X{"q0J'{0gHTSۋftVb^"yXRUy7wJIg513bW4fh& k$ Fģ=.n({nꮇ(eʅ@z&Ck:hVD$~9t/oIx 1Je1V⡙+eE^YF{'}3?RoF^C%c[ @ 5gX # d" J2'_hb3v~9nfQg2a9[S9'ЊGtdXkƄAyz(gs7#Z :U3l(,tcyy$4<"ѳk}m\{?*HLAZ1H> !~5oZwyciۗK@CG7a?ȝVH7u^F>e>%hL)mFf7wɴoD-hvOGEF3޾_w%/Aۥ, * X1_La޷K#37Pjb:?&Fݝ}TR 4נ|X Se^kOssN>\h+-_uFCD*/Z%?stP5g[ű!g\9+-U(X $bnS}F3SϤHG XPC0zxTcy_?-N/cMJƎ 4R)޿OMm&-Yx ^2%Zri\ Tc#TrʮN1 lھv,O"K욿d<'m|^Y!ܠ2]D|6y,.uı9ra[o>Eڈ#|,_=ﴥF ˠox%0-T:F)W%.b.ujio5qB>.~wZQIţG[_Lj9}ʂ S-RKȸxR dmI'|M-gLwd nȓq(!A,J_lbFmuCw ֭qGqa3  ZA;ƃ@ }$:fBA-^@fۗsJnVe=S~"F^8UiI(բ: Z[& kdZQ1aqlc+/?sY~ ֻ V$yNW3mWOS1x}uCaGcr8t"ƹ_3,,^h;(Qծ{a`9DߕqI$uu! ͔;^@l)iGÅ2Мk$dH蘑$pr!8O`vD% \VҘDlO SRh6%tJ,T5 Tx^@أmՙ) H$n_߭DE jFY%pxMJqkήaWIvuzL001y. K!7{7*9l%sa:-3%'k^xl v7*z\yxc%>\4/1ވ[!ߤ079x^ih4RDox' llii_: bkuZдZ mwz42E.d@0T%u|5`1зM.:B9eY -k$s{s#~| tUy} *9! i\ {P7oX` _mڊw18kqY];Z&jߕ IyotkDV"wzЀAm˧.ܺy4C)EDi%Asxꉐj.W-h+kyLfFVh;À$%H)JղL@NUz8N]Avȟ8c{ UOF%Jz?w 5/Qh;!$а^mDn2tՏMaywYΏZ!CZA!_W%$" zV#oJ褓=.Em L_G3L?t}îq1ѱY@d#fq fvL#PLmSJfzk4F/Xӿ5;z}ha'MdxDDCçm\^F\R'~F4JdF$%IE [$s۞q$; jd[=TQ ^vJ;|I>$=gB4 gWo&A9I@$6=27n`Fw>j="߆ij8boa!v4z pޒ7qM2X>Smkb3Sc&!"08Y#j^,iIF!"q pF7,1I<| sw'&yc7otJS2\Ê:G*ivO0D1Ru2"vbɜ<wbm4DٯT$КU,1Mԓljƒ֥b"az&r͂05Ff+ziܡi:[WT'<5 /dX a:5s`#'+-T#rK, ee2+s[^B#CX]L=_G9귥Mʊw/wpPN 凢w'`pyX;z|ۜz2mSfI C nDm2A3 KZ:f_R7W3C"F9f/RtuՕA\D{Ģvapu>gUob~E^ekwAP4P]I>yt.pVBg?CVƋ2%?/n쁗e^"aM< YfwmsK@gVM{!:Jo`#2#"e|g7=MA2COW$*/UfE( ߩP۬wet/%*8hH6D'5;hNW-1VJF  yV} DFCbJk#]̼k sGXD|ɥ[!vSO{Ͻ2hD ˭G>DSWS dkL@>`n$C"\L[0l>yuS;%c|4ÂeQDja->>ۓr0}Hl#\fTWٟy=Q5p_KzQ;g%+'@+Pq?j}xe압g$=|>;teShrWʋͶgJ^/#nrɺX n\ IPv|^Qi⼬*`ȼ{W/nD_XP Y9JĨ2v&nlI|#^?+}d4Vٟ)c ۡX_ON$6 [h_#6pyWiR l9oyM^;"]WnDgf>AG*\z<= $H w ,s>|XE'&ȧ|?[7羏`B s.g1Z@o ڶv#ב>bJ7JJ48,fq4@'4YWQʏqf}{jфf,@Oh.5kY S2 @bf/Kk,́\$5#Y :WQ *AN\})^37 {7"]jL9$0J-t<ò+BT%'԰?3 0Fӕ*<^\UBIW2EZוR%c~/r=PVl^cv|y8W B[̪:ݬa#}d\Z[k:cThUҾufFw/iX:8S+s@}M#A]Y-~ӦMc:Pa`2B/WE/̻b,&?۝r8vݳ6]<-3a{Z||ȇRp;8(/kHJ FM~T% 3~3(Ȇsz1d9 ,NНJ[jS |=]9YIJZ"Bė.=HWZa f_0 }{p]+){qH9u0ڛ3ܸ.obF~f]n{5U_ߴvV.o)[0 +g%L"jt# QANիIc9."ԗ\@SLiG* cR?9&gL ]],Td(O̥O2U5`+ N [YQ6HgD>-o$LO- =mB ɟ\pC (Z[ d: >{0L blL f}УXg Iv5X%&:i,<:_bh [YR+Y㡼/vpT!i.\ʼ|XuU0*DhӔGu=,qo*~[ [sLtpirLh .N>D4p_f2/x VHh!)L'Nc+\1>{r7l"lK^ͷ5MtR@nS5ŀD=#!ٵ`Qre|w}" O5%&`488wAym!i4Oӫ9u" }iRD4%pi9f\B*7)oh\2{LhXV? >sN YP曳fq I $MMI~Rx85FN"(nI[6]>* i٨X _w|sAqbJߒ?W/oлu=&AH[]糠=C_ |d(y]pQԠz1r9vV8`_qiqmҩ}vXR s~*.׺pK%KOFKkڒ(疆 ?Ԏ@_a~;YˣU%xDml4PRIJօxT-p{F*-X˶q83d]9=y®P4)zRdC-rwwR dY*@Թ=خÈ{=H*Q,#.cdY7o Zw]Kb!;xO|MT, _ [B f {igD PJ0ceARctHjp0}r#6Zk,G(`Z'bHSeNQT݄B\~"[`e*2rִJB,S+8_9HXt>PųL[EFRWlb#&ʌ/9a->gy.}ҫ9d4Ƣ#n7$H]ذA |K6*η<@ POC~\u33w54tsĢNf+Hנ?v^U״[h+܇ߦX4iI9`$pt$Ub fF<#Eu=jvf_><ԍ޶rfK-kS03,1T=B4 wU$anО3^lŐBB7+]'R9"2WM gjU]9)R[ʩ cPF!;?{j- iwݺHz߁5& I:(4*7cODgmg.Ao%.vP=)Y$z}"HN2tޭ[KQxG(+#B. P _tUM5 Q/U9AJ;J>]pj^oF6g+.I.;pQ x9|wu~ywQS$*UIsEb|Q⩝,sӯNPpJ?v#l 9'B1!^6@8Kc[FSݺP'2]޵Gp}' 㘪ڴ`&㈽[ x"PZs3I7`V*}sV~A7?yXou$*&S&O's9TZ&rlѨmakjCslQ`^H C]KEkO)؎ի&MhRzOo]4DO=wL5),0\8<윋 `tKiIϓ8ˋ7NOG ^E#]^QZ}O|/ʀ+3QP^hpJ뛷+X[Kbn?CfXT}#}vǚpvZg!mwO?.T2HoQlk8uB*670(LTؓ4@0>t+BwGȰjMSڂǪeg.\40̉ QRs"Ex'4wβxn +.f-n^wX->4,yXlmbr@F +b)6lP_'LQdy 6R5*mKoa[:T[]EDwb5;ML\D/((2AH1&Ttu㳰l4t,}:\Me;^sxnFP[z#5G/O@YhU 1y4&4o^SSF"!sRh$9Zv5\s\ \\>}Jń`s +,bZ&8Kͽv9GJJӑZkwS1mÿ;Ǔ };DO.)"[+9h Jeޡ:cMƎk; 9Ւ7WVh0aW$YuWƠ +'Ӝl| INȼh;GlrxMѼ%S9Qx zA͸O X!6$+qo\T&1FvX@͉opWӦa!+]v$'M7ZjFX` v_| '9_xŽ 0 O4OSo#SSj'm{8_T9Ѩ9E 7t,2Q.PqW]As.~?Œ=[!+uF=#YcNHeJF]ߜ͌K=?&`BRIB.trAPOTFg=PjE[KMB9z+(eCAV팗b U|vl) mv!W}^@.@Zd=͐]*D0cSIrVkI;T"_l_4FjRQT*.u߽O<ol zXYvS!O)E5De` Ij)4>rl20DC̙V Zޒ7< ;BS=uBgkVf"FB`B}fO=z!{(v,$r-Gzf#޻2~߼ìyqȂGcFO:ws|,4w6]-1+g y5HSDznOuU^&:˱ooWus[7yCd綾<%e+('SU>Y!;jM/z,Q~9W3'\DBz‘㥦ES$@#[I Cv9s'{i wY1N(TIXr|$|Q(=O b;#ʕ/`[8v^;Zl\/[^‚"'# ' rjKʭ͆=C-ߗUW@OuX e|VdcԴףxuN}no;΅c56 KqCfz˙צ3buVùs]iLQ:LD"+L|}}z$IU٪0wzh odC]0NukN8 m<76*r{p(:N稝vitqZXo Q練ɴ|ux9zc,:ުftfz9BD&滖O*ᆲ/֡ZR3cu&p+8¶jM Xl[`|c7v9}6p*Z`SYݱKPKEa4IVtOϰԲ$lmk0|5$V`8| !c-)BMJcș%s/1!\q%q)!Rϟ`b*s ܎h\`;<v[* LYJ /G9`CGۂ4H0C+t(T5 dqKX2yAKQs"<M^^D3lLDr b(h9 -! W8×8 G]0:P.*VC5 7%q1uj"I@*DT UHȣ^&WL`?Mz,{%ܗd~d[\XZa~*vuum={BxqVI- wKMuLFi6sx1׿D3ߐ`ؕpR䭷l17^(k[s_;?d|XJ.HcR 2~sWf -"^eJfmz>`߼{{ߐ8.D/S"Ə?{`k@)hadtc{}@}x͚w Hr% eOz~5ݑ=X 9nhmw>k )u T$!OSV>e*'[Z *і^Lz&d<v!^vEsh O;QwԶaZTDd5yB$ş vdH|ڳ_;.Yݨ>_C9uҘ D$|W ش21Ŀ`&"dl Arvݬ潘cXKX1Ç Wjqm&N5>lۿfd.gSvNG`g/ S!`0t*KA?,u9QHˎ9x^p)`8ݍ1TE9ɴ 8D-VDz&'Y'"Oω#ܡIV5`7yVc1Bҫ3&ҕ|60TRT戆*I궀sR;!OV3R㬥88 - [3d_ ˊbnK|\RI8vrX {~6=p;5*C{y=;ŦTigjn:A6]4Rn#mj ǣ/L5$AqorN^Hu2&HGΑ SzPlpU:13SӌJRiXabHYӮCpz-_h' kst 0688oڇ3@,ʣ8 &, ugb4mȅ )+cV=V66wv_LEqFnؔm)ǧ 95!T+ =6^*H+Trpż1n>_薜Y3瞴u3022`B\<8EؔW,s]toCD+} {%"mm4a$kod74!U?_Y@h7=|]hbUDx_خ#" ѢP$U_QFqLԽoR0ߤ+ӏA ӊ)2A)zdfzf_]g aep3ؐ0E ${֚\5Ssy,ڶdJA8C[DzU.a-`1 q.Am!L#&Ϩ%.ͅpXkFk$WenBq,@0FU;כ7s1+Ο,ᒣ)δ'JNGXK9řZkҽRW&w8<Ĭa2%oJֹ$Vtol> 7oX7ɸA<݊pk% 0%ū6׀,Lk(Xxhbzκ> t"Z)ݿwL! (Sw*CR'N+!ݡXT=40'M4c xͧAK-D% i]ֆ|52&;ʉ)Md>>g( 9!ybPA_ ڜ.rP#vxB/{T_4a<ǢmxQ16"!ܽ6[A9q1+?P?һ'2pԅ *~Bt fJ‘x&ɽ $G_FX赡MhSmlق.>o kՃvV[ݗKnă;#pA@rF7dXylt`Z * :t#Ccȁ A{@gH2z@v k!U!> Zaf#"4n_o I"J7B?>tbf'GrTrmÚmX26*4kY)WziZHK) xކԒNxhynMLN/8`rU eL̛٧d9"$"ŧO%4Vǎyte<9I-Xّ*_q.) *bCIn*RJKj uC݁Haip[0ΥLԊ&pc }G:$Lr6si ˾f v 읮'mn(hzƯ@ PsEmerNj@([Рn]fG~9̜qq05!wbF`RCޱÄF:~gc@??ߞ}&*M0,4锶n0tOtDڦeFyD*@{ hZ!D2j*wsaFU'Pzj @-蹋S6Ā 5cH0}@܄\<|o4'9h;[ #}ǴC(m_yc ! ŗfEk=8~0vW/>=|>wˬϖusxJ!7#Rj]}ފF Ɂ:u2j@],QDd5ZS XH9i@GY(A/Clq!p4 ciՉ!:keKH6)j ^ UsDC,^j@r,Q4<N礲%Gu+#mC::G8ZRm̟t͓4 HhG|?sh+`6{KޅP%{hok5 +@,ֆxb:?[f!I3 &*5D_?PF^.x`-) p1.lh2`wvx[N.RҼ2-u`,ꛚO%y;sepK>%a|.\~4=gZTwQ< ]DŽ,ah?޹] Lézf&DF>PmxPհLj/mS6vHtU u KAYU.KTFa mHe^bE1k,0Xbo 6kd).иd)X%?wU1ҍG0@`h[b̉yx! ag*;FU`VBEÞ7:uBJQԒm8ŨJNuGL8쟈&-ǚ* OސO4L%_nا߼h\e; ̔)٩4gvґJ %Hd={Jnq:ns;*|Xψ4e:/ A\:vJ1еUJYb(!6]SNh' !jmڀbh `>o@WC`dlI Q'f|<I 38s6jN;WMV\bǵ6,b$!mE׿awjl@@pnJyE 뽟Ti!xƍS]9CjN˕yȣ!~b<@̝Cv 50_ͫkή|HC@$tlV5d2|%-(!/2"ұ=j1aC7>*-#BO;#UGE8E-SEa:Vu/Զc+ )TedǦDVL/a[t{]4NwO|# T8 \Y8ivѽ/E1ޚ 8ȣKpb#%D7.?;L!e$7W ?($%s`(L02ڱ:S#]kfIpoe `5-IS/&:ZFcfq_A?f5D-=KC?Vx%at7o\mMϞ ,aƺU6N>=jڻc\8.i6I|6|m q lխ\Җt 6f~wF0Q|Ɗ0;ȉ>@ìmJRTirrU)ti- o :2?\8,@ āIؼqL BGqh[tPGfZ̡Gwpӡ]jH%^ m!zo:aKٽ^|$LV۞PwnyKŚ,]*%ѴOUFFiz8-|h8lHB-sPoAh9A1@Xit;T6*( x$t'xN(:ܹJw(;njZGUhE4W+ SK^ A#cYZ4)Ne qlF.جΪհpc)خ)>`Tڔ(>Xo W[š)[1,`m>frp#qʥ-h0C{ç<&$wc\``}"DYb.hs }٪I;vDF)4%ɻp4]0;-ro~ ~|~*jzE<{>Jy^睍z2m;W@H(ClJl:ωNe63 .G_R5[hݪ]? ` P-=0x$()b75bP<3!-e[>ͅk4ʹF0bi=fU|Z\H je_4_k*Ț~1S6nԐ"ZTCߴ<;a> ]uBuoml4sl΢PV@\\hbɮtoрTb%A#xqTk)st%7u4Re,- ;@=p$y頖6J9ֱ=E3K4%/.rΚ'+)u~A?V Xƨy#4n]9нh-U~2$һiQ20ͻ 120_o6Hz:ZVVl&r-+F`F*-&x::ڙ*0fV8Pgh"”LU1=<8'ujyΜiMWͭt/?H{S5ehQU= kShn!^Ԗۚ nnͷRx3C:  mzP*;cY|Q:Ot_o%ݰ5kSatbh &1Vem=(p[dS:t/0U>k9j}:c_˯џ]bx_P6x݋ǥƬ;ml!wnfJY}RıBB8<]~6|e$"Z9DKC%rMT@kK>s=Gfo ]1\==yc79fb 7$u9[Ͽbp3+."T}\ ѬZL&THtaaW]9I~,>b28\߱HEzZ`*>Y[j&=Sv$ {`i-ڔ۴|3Z0D4:7R-[\SL[NQC(XSypn'sa݀X^<ʌ}C*׺> Smo\T eQ]sj&v,[5|+e(-p<aO_H[Е4r݁}(% D~?~+FI+JK ߆~/p#߼Wa{iEUqsxL§ɴ=3,FfpF]JhXcgQþMؖns`O-3h哉Xm9"A$/KEYOn&Z2h ė(|>8WYG x}p͹9(9)d^G;|s:+R/$6Qpc3XOyyŽfچOtw5I-wDWX1tQtJ'HTcϮ6So0r0F3Jވʇ@5H'b@0‚(&(m,ʨNCߤ3FM߆_ b99_ WgR!'ɲ n +75QazYFm4zt99&xPK6VHatغdM7|?,dBSsz_` zgdr>`/]Sr-W#49L? = _Gtܟ"P0K8Գs4vW3Oj$rxI,Yt'_Uレ9Bq]lO32H~S&gk_hapdoTHM-n p8o=F^e^@|G4 0 4"EaPƵ" ̙2,`Ͷ,Om0dnddFN/_Z^tA,h $fDDlb^X 1? R4 Ɯl]&+/ +3Mlǻ|LNXcs"նԗ uyH>8?;O ®̓q4]Ǥ"jxdo) QtG J#&+Iv7~2:~A%HA*C[0夫wx뿞^Xɢ.UpXNUCs`Xgw& : }4tvՄ9`f1K8՛SeP-wLN~ }hMLPѸɯА(3o%ˍo#|V/z=,0|54X-|bւ)JB -ؠ:GA<eR:ޭȶJ\ZJ%J׫P̵(!"`_yAW$/CV$h&kEN$M؃(w/HpmPGˊZeRO[MiERѮk%Bޥo)B"L0#hϺi\MEwgF:%tVpeDyw{G/jlqS6DiPHQGiٕI|+N-vt Qewu|#GYcxtyi~9eGan[}c\"Hs@HN%ʲ"MXx8W$ۏ!vRjr:Aـ0!9ӏ(OH%Rk`Ž.xeڻ2]VܡI/ÏQyG-OrfvUgOZ=zG?x8׽}8 t_7 E&dD-3a=9TFvFYc E1E;0覜ti JYäa6C[h7OCK.)qX0v)% 5uk-kD=7A(ZL[Cǎ Jm UOH)6K&%y/o!,rƮ />t WQڗz[tzڤ Iޤ=5]C4YQ٨g,aH4~%_0- =>Si|rLTGbr |XTn`caX0\ .Xr@T}I<'~[}\eI(GX &TWPCh hbg(B3wƘf: .+[t܂eA _dߛ syG.r,2io(bd09!%@dloA"Lrt `6+HL{w/m*09%$uNTX|!挭̿cQB] C\i{p:-hqkq^jMDv _%k6:5w1"ojxK4Zj.ыSe -ڤ铭+-8P钰w,튛'ifBDEYʿVSÈ0Ȑr1Imj+)-1=jnkmdຽuChif`S ŷ0OTP/MSgkYb`#_{![ 'P;ekX={"V3W'3U /KSTO7Hp]yLO瓣(`^(H^IcPfɅMebCͬ)m1#tvqoHMy=4rarC`n򷑷w 90<ȏL./V ՝7"BcS!g'6@LeÄ:L}*D`T^p6뗀vNW m)ڭsLa-J#-cx'+[TȶgPt h7X$w 5hGEI"yUѼE.3'S{e_Oo\qF;6B`?WѮrZ%Rj\S?Q:(D30<k% p~3|clmu.1hE9K*!l:&(AR 9[fxux;u 9 _&ÿBlܣĞyƀf1E wabXBaxo%Oi72qa%B@1E`1U L'4~ciZ;Q٪*@'\yz#Ê0,^xˆ(APTjrHcʁQw]y˷dX~V;1GQn6Yfyunik,`ssړtVaH3Y[1*#6 "6O(6b dI*WeqcFTC;m*@Xd偳#z^]cC4"Dd«*P(¡:g:Q/А#dihUQПwR%>iس]BK $|.\X)wP \,o -jZ/Қp!a$ 4zwsi%:S)᥉s}'uDMxs Ϳe0&W cJ 4A~ DrK⪙Nt< *˔ZVY( `'29duxszL\sbhz=0}N3]܃_,n_Aw;e' ]8.n+p *Xy;^RM*2X17 .ӗ׏qv?OJғ׌mI6Ivp[aW² =SR$>՟B4ڧ{oF]5 f\l mek#m+ B[6oanmofm..xb<1'bev2'E2_6I_j#mnv.E,w~ܱ PcE)z<]/6e{=0V&5n/ p\j֫Db %'v, 7G,8&*.*G\># PmV_("{f++ubiX:mU1dF^)v 3`~Z>E6OD4S==@GR|C.ڮ,XrTp}O鶏"8H 2Q?Wi%iFB~{YwvJr:MqDYTnsQS;N,~Eo jU/qNwim艆w{VFXXbF-wZZt!m؉>_n;W1<$C'?z2W{*E ,#D/t_p舞UOF]b0rrrn硸[}t0N[{pa0ǔ60y`[oi4Of[W]ԣX\ ugAD疯uTiW 9lUnDN{nk"zգMȑ.d *d!dɁ~QWs)U`I7-B:J6)=1go?^jꏛ5hg}hQ)͑;P e*& ~powt)@'JA]T o1wmp9ANK'Vz8 @tqdǖ>N=ߎ"h&i'ǫ%8), H)tuƕbo,[m xfaazӱω=O̕q"S}*k?{ oDEN-5SۆԐ)m\PMW2J87ԶMcA:H{LTD|9I˵3|% 0- Ȧ-&4WNG]{[[sK4^gT$1JxC:?={w7]ܿ" ^a2is Yn@򤴏TP_#g<G u ydV*fri}`r#.GZlE`i,JpF!3:p~WDPiWm0|xͭR ="3uur7 ؠwe[P}u[03H(SVuhPAt̼48,ygWG@\ ^!`Qe3~%di6/LLYK]%,ѽ&- w!#wG 8`Ab1vF #6/_S{7Mh2d Bq}@Wbs=HdK䂚k+!$rfW#b7'Gwފ5lJbQf"S =}<2F;rjqL+|1qwgDLJȬ|a9 E~dk. TW$2q; i:7Yc^g&M%?1Pɒ\/8aH 2IʫTe&wke\#*!Ѐ[*)E'q[Ȼ&xtϙ[(tN tUzNJ]00Z.]2m*IUMmS*+/f=t9}:du|zx Y[P=O0A_#{9FĂ % t!/,Q-3wk4*Op]AG6qEES/Ղ6dI5j{5_5}t)Q1Psqq_-P;LWRb+ {fYBlf\T2~kOgbS4ѼR9 lLd̑,/yp6U,"g 0kݰ`4A#6d}LtBGZt¬e"Ge-y~c l- 卖zwWsT\xj4gZ#\UIZZ]dK9Dɪ}z^Tp05^OrE GD qnI>;Mﱜ,JB}ɧK#{$^b3Wh7r,quӘ#$W5/1>3šLfaNF5|iPF1ۦ˙%~YނnLrFl,cZog-qc0chNqs9h ӣoF$Oʨ 1\ru^eⷳN:_'HoA&;x'xT84#dpN&O7*À>j?UcN`!^SBˣ7{/*n.MUTx PXvYl2(C6jԎHX?E#yF¹hHxǁs_evl!C }8^Y! ߒ0kewC6MX Ȑm@,"3Oj9SfzbvK2$y0<-'n$j:#|3](Qo:y 5:e_-/'6gGt *B4cc1>*mFL V=DCDNl"hYϚm4[6?ǧÎ z^{irAq X%Q߿~#h'e:`[oq_dubƀiD=ֱ$٨Np ho#xmXux5Bz]˻tB-Eo*Fe"rTu.aKwjkћ!*Gqh5Bes:?1b'7BƠ_jz$YWe0O$߼g7 o#Hdr P{Ǟ9\M5)?-wP?Ґ;ǭ~`4<; XLl2$wC\gl(#(J Djv~~8_]rR6ӗqW ī>3" 0`-ySEVGIt6Q/ NCfUBf78=C"Q.k|eRyRJ~и˔%Lއ^L^G0hy%)}+ |qCߦk/Vp[K4tEH t'$Z 0 d^7X'ϐ}3acZTv]e@W|5Kܸ rd/"rV@\sr1rJඹĹ2;WH MQsŁV8[:UCV&Mc#9޴]z#C,QopC ]i췗7!Ȣ4[TvYY!$Xw(Rט!&Oo(Y߼1]>w--ua_̰J9@yFzXuyjC/Rr‘kS)AMmBOLsw9YHhV*ꭠJwF+R(c@8n˵b& -FdbނI`sѫ~9wFbNj9-BE<*[IqMBLi7H(r)."iI[f7ZDB"ZSºo䟍gBfߦIkUռ]+5f?tlx4Or:GNR2\ 'C89ԍMn4֦ >."zoln**4i%{*n 0$Ali]čWa\xQyc;#`S1SG-'_ fwMPaϔ0꾜5ZzTA!]Y .Ԕ<3$_WalQ1Mx_Ѥ#ڞNמ \(Ibv^n&~Fr|қ"CtGز%O\_Ľ).޵w&@C 1Rw~UՀ!M̱&WUp3MjЁ`8U0hp=q]Q&}[HZἁZ8)n`@u2|&mge)T@Re:Uj謌sD`/¸/ImH!mr(Qt9X' ׮ N+O xVq&k59P@n#+pջtj rE"̵Oxs|%@L139;t*ul7e{۞)ut]3o:4Pu<5Ui^^ H4vD9a|4\L;2z7F!OwRpCh9jJQf,t[/dR1؇u^IrS|H6nb0vKSAҧA#:tR}jC9aRi4k!x M6Yh[D9pdT&qj}<1D8An7Bv&jE׿AkbV /pxG^J l?Z`=0u +1NN/3pR#w k*YvY>T+o^`5:"[!=P!2%§Ao4 Amr9{fK1ͫ Q5oaBF.OCx8|w8pN8e⇠d9BH 8!Y|KkB}Q|ˊOIomYƌD8¬TvK0*Z"T^|PqHr@U wN O`aiݧxb>Ւ1I89.{ڡ"z>swsu~i\YǼz{|IvkAQgsqwS5&3ҚhnƣrY-k ̺<3 C.6=t,#΁pN:k׌6}A:,Ѱe1@'.{&)/8`{O#K[HS"XOqS8I~w8,r`Fi7 fUOm;~Ҟؕ02u>zkhtJA(Ɠ 1 K?/L^>AШ%Oc]xm!.ߺ9d9S8Mlp`Fc bN[-Vu®=_J!-pl`aog1htё?T~᥻0:Wn\HL/֋9򶃊p$^/D{P#/_/$˷+HE$j@B.Wf T4ljrĚKl2~`lw>2^,TN$3Qc9frҐӱ,7wC CiTtdYl#㞿TF0KmD*FSC{*s)dvmD$acraqUO4~3djE>8b2ހ YtIǛ :(_TɩEcDϢS%)ړ!p|BFN;8ڱX.ۏaJZ&R5d;tO[2mߠ^"?aI_Yz3Tb8IC4FN(Ǜ/Zp'oGVLs9p//jtX% v{<9E(>OZ _Zר{g?N%}7V;zl]n5YZ L(t eˊ;)m񆡀EylW:g"p3NkMDu1Q;I/gNdkHо|?Blc-2nӄ/cLm|?!sR_ z1~9XGї(q I\VrPS`,a{ӭ{b&RW⼼wcu평VncU S ,ՎQ/ɓ>p3AHs3aM#zyڣF{pA <'L Ufs}ӏTgD3QOlZ|Nq*z+8-UŐh)7B:Un&Pa ]Wݎ3ž&05xRr 4ebfAO\bWz@*ߖӀ9s3 X>v^뿼/@tD^ N fֲn֓54;%34drhΙꔡt%ﷂh/o'&32IGVP'؟I["_{[M.Se&i 4!4(  ].}a\T 1`=s@4/ 43i^ Wcv`ȁQԢY_uk8ymӻ[ n RH킘$"E+T_x̒+zf5 ʔžuapEr-:#lp4}߂X"*P uF]%F;*bxc`wH8URlTFj0Q.J'iY5Fы0_&M~(a '=q\qbk.p,㕷Mغ/7YX;H`ֵ]}3C2,Mսƒ糜$@ϫ);_贌<"$M d޹ZI*OIbMBmI vG1kspV|K)M{ڪwؕiƸ+BQ2 qY>?9 9?G.%ֲtSwE\hapN24.7[.bz6n4?ņ/y55BF9]M?2QV"iM 9,x 5R[*eױ݆LKߡ+(V9)i&`6AO,.6 bMQwY.~_;%~ t^+U#Vv߶Dd}#c(5&}\A.+KT+v'1q jΎ{/-q;0 Qnt[Kz$oy ae$6Mu0)}A e ҹ<)=tL~fsrZeCi[q-|Sfs (g8A ? OH>.|^fy'+VdIvߒ_\AOh—G/u. \?oM~$OBWEwFzquEfCЧSjA k|8@0~\X6䰾xʹS\r2XY9Z/pyĊI)R[Qy6P} б5"0/.g쒽ahĥ屧 X4u ˟t)6)zdҘ%sٳ!\5S}T[ l;B~nww}9֬VVޙ#|\Fm-@&YWVV5S5xx0EoL. ;]YvKV={@ 'cB(bh~a]2?Q##kV[g0Η#un%Ia&zr6v` ]D#O9ޛ95f~#'֨E1ĥ%`KzXzXK,;poK;kO bwm3(LJ~Izl${k88 ժȰ;:am v%gObtU[b↉ܭoJ]bgKb,Ŀܴ-BJ$<ªݼ)=X7̍ a~bP2bPiIV $r[]K8fd-(ED%BcBRT&'[3kF]a-"c8Og</!&uİ@*(H]B}BxxϨq6or굷Ykhϝ'F^)4gCYo܅xfa" U!SSqbSw:p<uD v%O]2M̢M?{@"p t@o?6D;@>$ރB=m69W<{ e\yV ' T˾g'bK4n)F[pu0bs>0vZԲϼxZ SnӒV1I ]JI:eFȜ[{&E9Zdb:g cIK pQj3 2s[dS$Ep&/Q4u6.뷷aEpQ~~ )^s| U@m[|9SYhRj|qqY3ImEUNV {^6$v>pP;fC#My,M\"FmF,hJngøxCY]So8ڟT?H{H$Q>ܠ'N&߂_O"qiJ%$>s@m5s2>UWZ38nT l0x(f%,^*wsYY>} &+Egn+*`@I;d%Lp]#复>t*1rKl`b$LKEc=%-NtV5åUh6ح6C7މ">= 6gGd)g7.U ~`LpSu{V)ԯT9bs`[8֘wj0 !qkzDg6 ;±-э?{:3QfC`Wۓ{l=)}et V,nk|{@n%{̎V8[:rZc /7S{ &{^o/"jr܄?cRKs #Fo˜Ŧ4^&U15c@߄"MG^1%;7%F6,A+V7BGL.;gwY@wdrGD- zm\Udjܻf2X~#vuc]6eKsEϥх{aQ82HH+GS 0@~m3O|1`e2ֽU _JllĤ.@=N8»@9Ɣ`$ Uۻh¸v*xO)\l9ArUfk^o$Xb9W H b{.8eG.*G<: V]*iY͈|Gz/NGLl±m J<;$ϓހQs67cΙ73xG;å8}Q] ƅ&dX)#y̛~ o.SL'״ad6f2u8gb!X1֤*HbSӦqOq+$,͝BOg˥6Ls q`d2{_a%x0RI\B\H"Vӕ6 k EJ㮉v_4[D63Uk S &UnUn&L&Hfi2@Z*4#Wh `~s]N4GGYU>B^Y*LT(E?{W^F!mj( ~эmb{Uvr-Zvb2``r@XA)3Kbop#C&$mvp;c 8af X܆Y@ȇp%7҇Ku'+ Q1 m 2;_IM2f>F. 2ӑ[;3œiV!R0}$(32YP9s1gR!/GߎYu+چ1z"#$ImDžqI'Cү*J#I˖!ƯPY!`E=31 "U6 7$ͭ36vТ(#II"6S>=6SP_##0ԯόӚolD^ O.=tT {YH@^[9e<H6y7]4nDn)?煉_2սg;Sq nWC:]+s?7tBq!ض<|N)eở$_C/XP;5a[eZk\!m]˷ӈϩI@A)` V5(!2?d azﯔSD1,1Mןcf],|惣_L4 D'7jt,hMGyx6z膳\KPqڙܐA jRtMh? \B#;ll@)(|!Qz =g45phL]˴Dy=|ݙ9lsi9`R[ ޱOo kh-1TZXv4C{:3Ed.z2 JZg$!R( "g@!GމPQ;.#*wEhGeG Ul ۢMaL,s3)|L6$MV'c2#^"|R%=Tzni3(f;W^(&Rr>Y|7 $`"nN1YyNOHG+Lb G6},MJP+ߏ&?o h_N"^]bZPҿѲ k? 0(umNo82HW z{Ps?yҒQ+~IT( $KꩮhCXx(iM^ɵiMlXmqw!L Bw6Sۖ%yF33T$z=+Ar!t @rϘVǓ!9k1O-SWӉVDǍDwӸW גn?+S LVs^[6EJ?~ҝoJ@Vu#:l2oA+Y[oE,D,XX!-u7/}7:\6n~;n7 Bg U%Ea"Ü  e7u$wiYZĨH*9iTu0A𞻌M(_RmMVL*UIEly+;GS|d]8htQ,pԺ:d~. 6C7h^i6ث[Q˜m6\V~+]&nrWߠyF؇PO8bVqsyIS JSo蛓HO2*-nM(cTqofa 9ܷ4La/^kYˉt&p@jh.U}F\rR.[F<0ud5((!c'k4{zF - ';cMvwb  fJ-(O"9q&j^Dk7KŅP" Gu@Q9}x;,A4 )sEIfabǟe,"EzmZ&y$D 5M$g/9C[z2]3*QrwEfVʨΎ;3i#b! с|R+!ǝ1p/Fouy;X#NAy~=SOIaj \OoȠNHn L2 o MPdT2c !ak>$} l<{-M _:{Z)͐/9BDֲxM$x7k"'TL"r6Sd5ѫ]hO^6s7|UfuNzhj \LRK:o6ee7U0N'`[5b"G茼8Żv@vxEwlG[ϺTm[;ùAE7 ?@~Q(jQoBX^1nŵB B~J8}܀uEJ/'lT"%yqǰ,uI/9ܡTM6]-<" {X z8ڥʴ=jnp^S(uSa͍!^/V1,HV) T/ b*)Q}2vɃB2W:H^9+x*Dv| Z Old v@Oh Ĺg:W|=SߣrI~ } /RTיh8UJZd곷:e49 L"P;8'يl"x Ju/$[ɷRR4yHg ( ~' 5U1$`ص{d6 :08[:zclMq{,9'z?ۥN4>l%@jBK+nPCVeuZ2"gw*ujXTUl›D¤K9,x*0H9yhޝ7w˫s %)<MB8zLF<`;z#۩JZ511~Ӝtc2,vEr`%).iHb\Qz+)?x2򃴁[u>nao!A U{2TO.Dj8y :L8+E0#q] ST@`>Gn cހ7Qc|b.[DVFZpǟdd!sp%R G\Z7 P3 ㏰yfbR5Nׁ^d(&d_zql6ocCנ_ڛ[<0ORҩe(S Hc!HN~;Ye37ǯ⌄#1N,8B>\H)(Ԏ1% `yUƩ'_"gc;w}]AxK~i}6`<zҬ_:VfISؔ1{9EʧX{wݥcv3ʧUPoeq}af9u]J-)f!௺kI ŷ`R<4 Q}l)7Ϥ'-i/̀濂kB} %cpf$aO? $)N HRw?2C9҂HNFָДJz!9"̷#ġ^|(w !ufEVVyJ#=c'Li9r&]#`FU,׽Bڳo@^TB[ywLF Ke 9,)O(VH|)RNp|֞O}$dVWB:^*eh8LQO1:j6n2{VdSJ17AGmJڋm!_JßDyFG'tP 64S/t]=\6q$^7!+өsac3Nzbtԩ?qIΌ_3~I:. QWtov\#}j`W_ԕ$ S*g:Sk/TVw E>_1[LJ;c]({c%5ydvcU0?1,+KbM~ ->p,C:mH/>%PӠg/^0 N 䧗1(EU*̛MV55'B'QV;x9/P ",16EtM(S"@.nJW= IbU@p9Z 4?<ܶ:ȺEq_| #;:g5ˬNP}7԰}?sLGOo{آ@hVW\uOL(T-e3鱬ј7I;u -2^uEDh񕸐{xZ48m9yMs`ASH!厁OCaCPXݗxBR5{WB ncW{M:>!ug;EDOKB"/Att+Jy"#Ao) t(aJ97*ĸ8Te=LV5%8d:ѫ"+[K2j+|D*-Gg8-ckpvAɟ30⍘(۞?tSI""Z+tًrBIP15Ta@%~KTec4"H<$w8mϸBlФ3^tO\3ם]@]ةrt5R8SVl3vIc|澺BO_Dx7@2EYM2ӈzUVv͓yhnIM!0Pe,)}Nz,iIh~C\.u?#Wec>l.?E0YrⲼebYg-(&`aր\ցt7>\W3v\_SfveDQ#4/oζ{TLҭȂF@&`(_-͏rsS8؊t]a)$ @J5}̈́PL]= QX1B d Z Ol)HiR6RN;w 9P*r{ rL*lv.,ZAsM. `6/S2 fދI.dش]; o21Y{ūER,ĥRN wz?y>CZ `SRZ7lUdK!v#( v3C̪_O_*~ .n͑+giA2?l՞!NYՙ-L?Y9\1饏bSC9qODŽ'/Ge4rdk%t+נ璀ZDžPnjxA®=DI6+6Jn1bu[YH R~Oc (&2p`=({ēӗV.s@=̄hF"LLr&|Q+}E&Y2yka 4Ys7(3>]}x],CX 1<)\#oJ2ޟX G(wa"iԁjZめ7G_P_,6^2١lR2I%1bp- [#!LMm9Z}8*Q8EsZCBk0Ͼb2+Yŕ{뿲WI objRLN|+DJ!B+(LE>ɾkadE]8wD嬻4 >rf"]oaʦ7MS G/Z fG&ő7+Y 2l-AV f7s?C}=N[qz/N^EGZ堃ѭ]Wtx}2!WD>AȊ2˙].f=\uU)p͘M#[`bP iz76,s';4;9 huYƹH4øxЀ: y A2cCXgRDJa `9ԅ:[ m) R򘝮F#JS=% rVݩй$'6]=8C{%BV uxnI2`e b۷E:tsSFC^l.a @;7E _,P);z)DVHCfe;@E1,/[Z-e]d]ntBRK"ͽӽ|ʨ㐙f"c`Ý?kWnjk ']m4N(!(}Wl$ބ=J*EWԟLFOyyEXgu-LwQ* HԩEM`C[43Ykb7+˯kԷc4Լ}ydpayNNv'i:ph\9 C bSj-ٹ!gbD"ŧ)rpH!e]Xi[p*8{=5ڴOu|`gV`yB}/N!" őIϙu^I nڳQ~;A<<9۰OM^Mi9Iaܒ)EWxS.wW?5*2CiA^b.7ε|E.Q%&= W $LzԻYT"2,,XAg55-" Bz36%g8 N ["oGAQ1 *-7VQ/L =^(Hsv-(8i O&2r!1syh\Y/ N]A%s2_Z 1ψfaWICW4|]˿5 CF6TDߢEYRP b}guo4y,Ug77Ns Nz"p/4_b}5``#nEaLƒ\|"RG׫TIn1UaI E/+f?M[g"!h^ߣ'AZNw'h0xԵb eS)8 N?0uS(Y=W-!@Q?$*N0FJ!Ar%8ƍ{Zmg [t@U Yƃ[6~lۘ0?.o(ͧpDpv.TN7g:3QSdd"}B]H"ȃ5޺LxRnwGFĴ:3=ϸC@*Nf~ګ۽O6xO[KHf \#;[}^$z&X rKO` ''g Mch%/|y gL:)>BPyu5w?,21kTu_Iٙߥdi8cj|Be PTuNDs-J1mkS/SCEgYä~vg .*?xB2_lX_ʝM~]/^օ*-~y%rԡu1l9hl);,1s~ʾۇ̶|=nM5.7bqSO6HHP`~I9^cz_1i/6Gc; Q1 |AYAKW6;\yc%I3'EM\Bys9 hv9)0Ԇ7ƴz9IJ;Sg{镖FUS:|(tjjvرFj3|Bj e- sZ)I`! ?}<2w$%$ԮmuxiPF79G=܃;c(ZFZAk@pμ^^Jց8>\xCBoGc)L|8S(jFJ GNidעؿƕOBB~0]u{MPLFOPZ?4rcg,O Ly`5EdaiIKGj?dz1'мY5 }+Pi9 $&=©__ 3, tugĬl6u9eR-A}]N#g`cj].(c^X1P} +<%ʫ-@hɄe, "=43IB*tNQr*(Dy>JM V 1y(Op^&1O7Sߒ_z^d2=9: t($MBƭOg[Ŧ i @ߟaPFiHtc `d}U`/~ʄҥ[Zƨh{Ez5Bk>?Ԅ=fQUZ"-g0(>. ׷Wگ&^2rԄm~=psP݃+ 7G45󰑹 p+ eg@U;;L,DOzT7DPu*e4jC^ TZ@j&`aձ]hR-VdȆvdj?&N9FwOA16uFL)2g^1!rّ;8@ߨ}Z❬):9PA^`/Z45]}qe5?VWK?9L+amm2J4,.P@|n;a*.#ՕvZn+/|{1{P"-J o!zC"9&4) 5_JUc"rbJGf_#%E~;;wT u8YD$DkEla`˕{t_'g"mcuCMکҊP !5X.0-ȩYł-lXz~}{2Kb@U|VA\;J0+G ? aB"edT&itԻ:/eI H&ZUV&|/!6SS[cvrzH鿕lCPD!vi URs]N⶿GϞnDO&`v@^ 0Kc$޾sfh`dLWٰ8ӈܪÇf*)QvML"]ilo;d"2x21 ݧ 0ݔ֊ (# s0i/$- Jo tzWֱU4 uG" ={s=R& \hq`iU`)~&%ud+ZrI/t ~ }n'y/ћo}Ԙf7%&qDZ(t PiSptEt\bbphֹN-ϊ!l89?{~QZ|k4.(!ѯAv$\D95M1;aơ4D~(SNʫe9MK;#mިj[n8EY扲JsAk9頷'\Ԟ%ѭ9@/!{ )ժ6YZr#zy,fUI$Hm|)J)Wk߈2tzBka5S@zE*IjP 3*<E>H/Tğ JAoRƙ2NX%K|ȴغNHS}M2i!KE{Ow d4GyV_{c<%mdyn:.0󆽭kwͿ"|ޤ"KԀV@C,;j ꅱgOTևh˧K}o|ÛTK]`fchFcұlNAJLөcB)* wcsbA:ot; o+ht)Ew(`Nl-wg` 0ӫTtRM2جyh5a{)HOD)K!xHhpqwtg9j6UAvXf 7 D>w8-,0_ڝ9hrMr5'dyU=$\{K\ Ձ>I”<5D L= n|*к~k9S6:e}w݋ 1lR0RRM[tr*>VvTuxLo e-9,n²q=aJk|TK-Q3 wuϯGD!@33iC9,^ۍwuzgtu|d$7'JT˛%V֬ /j\2D!W9Iy:y@ӂ ).JeLbBɽ6)0n3Piz< sC3ciɀf9kE4NX6 ^a/[d[GHj9y{tVG~tѵ8{7 園5jM{}K%VpAAֆ' 5y `U "qDTޏTDTyDQwWj/":8sv0`tcZۆiV0Twյ`/MTj o[TVZ-V"/ӂ } :yS$i$B;RyU' 8 Ni7a n7B5 " \ȆT!#@uJmq@QՅ~V.崆6F־n|UչrFh^nUVhUm]8Kp8pӴx,GFI CY3*xdU]AшAj(0@`؀ (Tu4Ӗ"tR{oX%!"yjMm JaI?7rik罃KsT2FZթ)_As>I&+"*w( DS"WڡD2*w.fƝnsfjﲵ-7 XT7#JTϕ H3 e3u$ʛ6G$08%.*aN:$d4f y Z@K+{˜w,`AND颊? CN* ⢿1QK0D DD_'G=[- To[o\俔~ 7_7$xr6-MR}Vwݮђ/{ݘ$\؊ \m5M~/ߑ۝ȍQ`l3NJ 6G|8K ('+sob(?J(jɣVϾZ7J Ki˫u p.qAdű,BM}b~ۺf6r:ojH#tFT"vfh݂Ⲧ! *!-oz Óz0}o#FCU0U-YrUS<Έl_[EՊdTxox-'4p=5sjPpd}>APd0td\5T̊.¢eG\{־(Z捠ɀ3 N?:_7[ LKXוZ8`)*Ԡ  XggDW~"Kj7g:Kr<ޢ/\"9g!Wm_G}AңRhn@ſklڪz\P w &lE S.@ 30А[3Ǘu]Y*d*\#"S$⦜@wP?T@˄<*Ύm+(-wѩKd[D i'[ha;<?q&"@ȚP(y Ӕ7A w=)Bd=T zH֙b4+;_q6$Sy(@2=$1W@_P.:)*E blЅUi $Hz IC7[qqʺU π]7S.hͪ|Mbÿb7kBV$#x1$pq `u(Rc@`eQz~0A4R"q@L*@g[@;JM;K[V(qQ uia<*.2 -:3cހ,Cb,p, ē{o %}vv;婼L")İ 0oӐԚY dSa,D.@S.jmEWX_*70 k70|mĺ!Qw43 D-TTGV\u!+ pܒAaW':uˏ fm 60h-5 L>Cagb0 ђ}X|&u'ϟkPDC;{5_v{qºi2|L^$ nadn̵Vma"tA$ֈf '/̨9rw\Nڴ輏~UyەDE/fw0\NcW`Aѽ-a r%8YqܕsJ2ފ,a8մFWն- è;r2r%qrM* E˕ OQmHmdAHȢH 7 ;a[N!33 d51c Sc 2Ӑo<̀aC*2}<9N:ȃ!dÂRٷ&X38(bKCSnIdQ;H xt-1@zﺡDex@=Ef쥙;%[STznмrC `Bf^@`CI܇D@  t\9{nޝI$p$e Cz|W˟Ns޽mFիzw9$Ow<zwEvtr뮧 ǝ{9{Ģ\QEp I&$H#QKZ}O;g{ۼ{=ܷ]wuÛwwRᝌܯwm E$%0IvAB]A)pv1%ӹ8tIUsr׼wSwΑvʼZ^{%ενy緥uVۧ-kmwn+BN$0!"R!øtB ' ӒȒ.:,tr]{w={8OO\f:NP3闀7z@)&(,sy{t{w;-ld"N^ڼsү2Οwywo=w\wsȎS5M^;B9&DH,RN Cvޝ^a;;rڞ3ڶfrRg$N\.:V6o*ק;NctrA.E2l`RZ\m")Ӌ욶jp. b HrLBwwI:Dwpy=jhQV1|ZQ]ذP<s؄x( 7nwMOsEFϬwHm[W7ߣO\:7m]|uf6ZߓK`z?cO|8|MV?1i?63WX{o i`Q~;5=#NOm]} |Kw=MVSsn1W1{ j}tq~cˣx+;|k&.$֏1~.]c7[W2[oqM[w>G:XCA{\ר_O Xbeog}3m;Gs7h{H4\Ac?gwH ]}⫷\G=>1VBq;ϧ;y J^#wF 7'h8Zr,xrr5~y>E7w1r?7㉟n4{|~Kjy,`^ƂPWPw>}6wp6b*fDQ'Q;dP|@ r1U/C)t"ڡZ+GR({M5"v jtUTQUPԀ_ ~DA81EUO݊@B9Gf @Ԋ"m *E[ GLy0ݯ{vlQhXhm0Y6CDPeShd.-.V(H'π@$Uր耡:d4t\@PnTTSyGCN "X P4*MXY LbFw[~%+mmX1 h!QSZ*l;w8u tQ0PDԈ&8qTg )VaR!|s޿;R4bfId Lb,hnk%- EFMo|$-Zy{X\]$i*`k@:կ-[[+cZ*>H'Y^M=&I$$PRO@)(P&";@xqT@ӊfsHUD^CÈ4sB`ed\Qw . ";1xqEC> (*bTV]Mv &\EpA@ʋ"q4lՃC.H&8]ԊKԩ4(5si lU Mk374mM8 ?q m }kU7Yz{"IkELubzQ3ujNqA5s>*|5! PSxqqL+! ՍUQmb[X֠V5hj* ETZZZ6Tk& j@mhj6Z"эF%lhl3$j4@3BDF,)@TccF ֊EkMS;b41RHSrкgmm;:`\eo6|5jXt"VYт85n Bq,a]ww>nخKYm&U& jBFnǂ >+vU-+QRuv^5q|^F8݌X)T.f<:Һka\*ٟJs$&n.Y-J b+IzMn $,*\fu)^YEYK(ŨcS+=R#q mmd2;Q@3 8;lԿmTc(?js.vҁnnjPmBQ4pXLpw^!vM+ E7(;7\:)"$t _k~ZmXUs /!KB2#cUZ-QZ6UƵEX+QZ-mbhЁ؃2j6;EHF1-FҒJJ6b&4cHL%6Q1Phj E3)A^E4bfDIR0ĤY)E!)+)cѣLAQEFZ(ƲXTmDVQQcb6E-*ث&VŶ5Qcjmeݱ쨔;VIIPc3!ĺ 9!.6ϳj"lfiXγ f7Tٛjˀ c|3M3csK7*Y gYΨ0aKwrKؖ :qL+/7km5`\Ȧq797Qֆf Û E ը_FkrV\7:lҊm^VH\WU@51 HQc]@;`{^ku<$?%Cϲ^zLSu̶8aN|1 0ZtP3r!-0 \bw2̛x P̠yXn.7 W** F n~)blmEQhŨ֌1eْZKL(JY3cFRRMdE4 1Z~Yw-N;Ȥ֌0:v9ѷ6D @/ H-JPe@"I]1롺Tu;5KCfYrx,S9yKq9wkx@79 ܈f#-w"mcËR@ء]qdpW{*%PJ@͈).ƹߩ_7lV5,QQ{v6 o_~mn~}~nEhOG߂e@ -M-3)]μ "o5wvDڲYO,ʹ»MYtܹa%h[v~I;93na vk pCr><]tQG$' գٞgO&v<9C Y @~NjoԖ4UENtR&~6ߥemb"A$ݍ1F4Z'_ySCH` @mXMz,q!}YouC2V椼3I!"hR؛݊5 l$ TTVD8x:XvlsMP⭢ӆ#~ѶK0b@ 4*H+‹+ytx@PQ HȌ6mA$D!%&(@a0"N6C-jݫӪ2-Ʈ8YsYV(K{T׈(k1xWD(in)mjBmgY5,Vg` y+>3t[YSGzU'W0,Xo$o.iIx?"t@Rgr`8nAyX:R cݑR5堁t"h'}Ս&#Z*54m*ѴjkZB:Cs4&~"J]8d5Hf$PdXYt;H:rP\i LJc-'v]t tگt6۳ѷ.j|K 65l5")ҷp5FI_L<:}M[[h1sDb Jq 4^p.8AKA7%Q/HAp#\   n hNJ4`&!|I@dFhE ! *Wb!~!KJǫBUӰbڡ[ noգr@cAK'f78H3Ā@a հаR*ʀItșwx́b5[G Oo;9Z h\(kʃ@fBD6~; ;mm`yPV+}m_9I QjUmElT" "H;ܛ~EFDD$U TYA]Cͳт!2Z)h $(ySh>IZ~ 5_}QLݞ)7Ƿޣ8ToZ*>שjx7Oon?_[V{M?CeBom~Ѧ;#nw3N x8\Nͭ^t>m+,dLE 14, h=PtǢpu/e)K;~zLG0f6qJ7S3ʻߗEAvWӿ*xвNlQ/4 @Uٴ2ѡdF2,?Yp5AL`^Xdd%VQv"`o"hİ0X^9[iPY5 ÀRaPbpF:Z2tP$ @P/0g٨:#u-Q $#ELuDԪnAv 0R $Lu.jJ6D.""h?"C`(9]ٝ]Ka1AXtW9G䢚g|E4(%N2iD ֺD0fvtbw $]R*pw`TP@рHEJ R5jָ}WU -+QTDGR*:1k54[~gKsdw@@0Y[%I0Q*T˭.Z P)`r0a5vL7K0fzRIX(j ͈̈2ƫm^k^s|m2"!"/)(@\ %,q>ٻmPY)!|+T}LO ^R8#? "G@@XrpOF`&WV*;GJPuN#ߡ s2VUlZ$apTW" uD6b_BBIi.*ԷUBdABD 8UT΂ uҠO<ΗE|U["Z fѦ5i#&6'5prA~B@0J .(Bo(ZJ`@u|!%-i*˙*E2쥠Fl%1/z9VEIʊ5E@rDD9T3*q--QW "*GDO ""( *u|Pk:eе舿I -t5YRrTb%)‚)*a##0 /v{TED3eM-$Dc[m_zص嵍96kZh6J>"#xrxw|Qxs gp?3yW#yq`˙Wt],My78@,B* 9!pEN DW 3E }{շWx]t>CއYF="L5£Uʃ]9aR{$?ڮHCr\`#~O%wܛJYL!D&]/C0b|VNz*%m#{ BʵL6NHy%[ .@Pxf.ԌZR.M4qmmNaieMNQy.}: (Px*LZ?aF #G [6\&+<|5+94G\L:_iPEsio*⃜  z+/R %[ '𾨗~Qqz2k}Ŕ^+e89Ro]br.v(Yt8ϯd+!ɯН |8d !DE$]paBHHwYHBD$RFE$=F-kgwgnuAf")V/sHo.DdM=2t}<99%v %̛L9yZTs.ӓO4｟ɶS=۬=b~7Ŝ-Ex}bf1Fq??}k;G:l*I ̟;}xO]Od{uϟ3(owQec%G^kzlusa*C|d?emg 썲CS`p]X}.0^! 5yJU%IZ6`XF8aY0Z3HEZ8ŧ!40ֱ\Q$Q h_ӮQ?uXr#»cNrDdxWkm|GP7syޓːpNQOx9_W(i:sz "!$#- zWBbVxyAAք䕳,BK :4ʘuĀԑ>'4Մ./f:{ȿ1%[hP3[;їQ;7LxYQ.&,ElZM*ߓd5fLKN ٕ S-/VilvhƉbHH S澏 a!exT d~1!Z> !O?#"Z Ų$` fw ?j) Vj`"s*n4&yJJ6AMUqv3*\l$9Ju3iRE7h8 fMfSv;(|P|?۞AA^B)6C9ќlN-#"2bIt=X/m5u9-0/r}>S0"+:/?z%ZՎ*s>21rx(۰d cAo19ƈRRLFl,jsd2~o_k39[4ma8r;Miɔ\elZ.#_ zĂY+*_Ev<\&{`ÓRwF%P+&HJ4E`q9 M:oP4n9|x~49J6N2p~!|IkFuHӵXGvh*,CfE!MExdޠV4ŗEjB0Kݐm(AP-ǸQ8m)tX7-`i F f@TLUѐ  %ZIjԽzӶ`~\ZAՂbXFlT lshp[)16魵Y6\P?]T)yɧmtöZbm"ӳjLh:IXH7RpФǁ2gc"@7̥ZhÓ!iC *HXM|\ᜳEboLSk0Qi:esAk)*Wɺs 㓐xVgUYNv+̭c#* ǶX!W%QXE\WsSSoe<%DMBwK;F^nx)J`d Rl0[15;d(QVsN! =\WrMfPZkYKwaC1S¥7,tc]ZGwȔiĖ' ${fNgRaSj,KJrKF$;U֣p ] hO>"E$jmI_%RiMMq(Uգ۩~gGݹ/xӀZHmp5U BRr% \ &MwwFA5Dxl^M"mu-&c54c8x~Xd|`[J;pWbTh$]i1B@ʡ}"P5l{w}/L? (Ya?.l(U0AI|)ؑG+Þiԭ2=vJ-0xh}2:QlS4v2|E2uZK\<9 % Ap#]N~Q eMUEFvN^ X5j큭jpf,붯}r*A95 5=?(xĪ%Zz8FDY@ȌPMi c(,`>{Y.zDz }\4 Bz8O> -b$&&JIcC #7}N k ,H `wZ϶Fk> 4N"* ^uQf" RۢHDGU2v@"3=?{[,{r%L s*Hʹ!cp$-WP `'}@f=(\MW?mV!jDDe@ $ޛ@Ds\)ԁ뱡\VшC6ow~nU\(=_xwnxW4 qȝe&P H+{@٫H{!E@˂;xQvb9D A"*  *݆Gy*A3KmA'$ND#zJ+ r [yEP@Eʀ ?RpLҊ DEӍ?)O\0 [*ۄ-N +:z@woxQ?/pz+8 _gQ`S?0V \UPCEҁj4tRD ss eR?+iKuI;OD94 ߺ0oꏕO50C@ 8@2{M|xu2>?Kudb/y۲!la$4 118rd"g@l lη‘Ce6OF u.os;f}I^OJLO#9$FI$ AǸj$ 3" io'zpx/|m&5JTT@ Lh[H| J"gQ8;twG7QQ#:=)a7^yq4 >t/#BNk]7;MCy˼q*QF8op+]W~sDt1 _bڂm{qby1u\zr27B_Y2qwGd@ dYFFq~ֻou3Z-8O8& %*j"1%̊"DŹJRY`VHG VypgUro%8&= 9e8= U35+(q3%>n܀G𬞼2k+@~$c33wAmsqfg'>d ]ɛ6+e 1>_% 7_(D#%UwG/1њ ?ªk%8q=(tIYZiP*[['^HP5j@@U5V΄f !HQVPXbI\]Y S/!4wpbBck+pƖ I bp@ٝ4j:3LH-VVeד]lWg80ȦTJ8 hHeĘO^٠"+mVB/\PL1@4B1]ypCPټOx+B«&rN@%O[nڵDNX[fJ r~3X,:ns I+%bg> ӥ!MOxV7uiZ: MH„3 Ca&*$<fYjoh^ښ{H fwZ1#H%w #=j TsxSD`7FK=qVMwn{R$XP{ `lv #!78A4o?-g~6K2cbzز9`ۙFO 2,ji߅$,`+ R?~6oӂ֖L/0լ5^zզFū{l8%9OK,ٮ$ EB>,`(t`,W=g6 ._p4X`5[)rArV'Ɂ;٫vlәQjD8¸zҫJ, "VJi]2&o%:&ՕuNJa6EQ3l!CR|]m ۠\  k18*L! h!u5]6ޛhVsءz}G>}c'4mnLǏ uKeu]Pavߪ1y>׳pִZ3Bv˻Ygs)A梠<8* Am>$SqU~d>$sEHq\৕#q*>~ =WPNA ͂gJpb"QD@;]=GN HR `8*wx"hE='f D.9"Ȉx>' .QG'%@ X#P0 ) FWxYg>7āHHH2! HC^%ILv Viv==SjUSfejKso 亼?i;f(;{^M E!$7X o?`A;~ǣj vZ4Uxupx쒟@"  +_oGc6wDdHNo9,}wd8:L ;ú5t_;@,az0N_p,ZmU[y<> ^2B[;VYx#RY&U1hs7 n7^&GnwaʦQw_I|}mS)=篪l܁ ō]QQWgw8?ԁm0!}xx+^ؿݑq]{DpRD;>Ba 5IxwHJ <`"bE/(D,"8 gK`HgdeF?/Ȼ$$_}r3vŮc$$f XSMF) ̑r\g>bШNPw^Pc&@ߝ)o@v0"$vrޑRjDl ́scУ ^ 萒TZ99V"rc`0 R,6pa072'l&=玩ȇ!%,H mbKנRϵ 3B y  0ϯʢޱ#!BJ3 `ȋm|@c#ȉOrlhR_4wsԺw6TRA"$:>+j0#Bl6ϷxXBN J_4"&D]qerؖ(Ң7uGTlϸ H jNEԹ磩 ‹%fL?XզsDC!Fǚ8ZwP.\Y!7rTv?mT9hBykҘ*Qa*!L(sKP vKl6Q4.D|rAR@[臋E%ZfPB "CYSBWw<aΆ>zXQ?([["gyGW%yw$@& åҔJjDOkPVSzaSW# 6DZ ==WP */Ԁ(&8 |BDSUK "x=1E{-?=4TOKR9q |{ b QFD2@@DN UR耜lW "QTw@CTP|^ӏye֞``#d6 ~:w;He߃C|aBe3Ko κZ2輙X6$&lxR7L `_E pi<(#Ǧ? 9pf/9c^7k~ߊ:l~svȻ &_9=sp.c)p:UR7~4\ p mWƝ'^:|Vo 9jㄌ MRÄ~󮺨dM 0:wQQͼM=ܥ/9f>}.?[f_7 }⢎I !$.* KoqݩFAZ˪eMDVn_{ƪfXf|b@E@qc   Fnx4GV;?o$.&qh$U'zR@DCH k_mtFt6S;lwp 5˰rLK| I\3G~OTU2zv볌l||_R0fj@H,go ,OOD1;NEdf<zJn-W :vjxذ&62zJaQ~| IăM47|4>Zw*+ t+;Ozբ!:SȦ K_ުĶ;1VJi( pFAUI&:Ԇ{IgDBsZ ]vJ59хe7X wH 0@&"`+0C]VRAc 8}ߴ,Dd \94x! 80]4!QRP:\ 1%IZBɛ+%*w)&8\V lZ+[PuVdL cKTZ#rܐ9!f.sȣ#BP{RVc~ϛa%5Qawx"2-$VO"j~+R`)bd7% cM/KX媸 SlE3G*6Y42L0TI*=dD|cσel˕6պ< D(JrLGSMˡIAZYZDZU,ͱI5$Db%Li(E-q>GϬ&9!hH""t@ BW= K3"̔"# DH , u-QZT9sGPVߣzTzIq*ns~Y}}{9߻k+~oZC?Go0K0OGP {#j@'׼Z:m9ĐzY1c)TA` ;>2X!߀ "kD$-A@SF2k/C?Ccu~ #wM]k:F*taL'IHΰ8? P`fqtҪ@Am>oT?w }ބWսEU¢ԤSW)C*gr6$ Sd|$Hr@B@$ ݺ>$1R$Ҩ@7y`{')^=?N MDH HMH?Km 3`zg̃)R¹dwRGyI>d_4aH_ܸBwB&8o}Y3pvR2f P!M @n@©!#!!$z { A0ipk̗;:h?%X#'D\Ѧ#xΤWjڭ5W*DXnl*@@%3p' 귖!ͯmJ}aa0,$;R,~ e8{ՌB?l컌簆$ĐH&ag /]bg C%ދ$Ub% `ZK ?lj bI X3G| |ۓx8k f"$Mc P`j6k, A"!H=H VDKPdfrJH!"( SoBm86*pV4*$h(`C7 :FQLl*EH%jgLٍĵ.ؙ 6"֮SU6 $-P{ ]8E2|ȁ'(:ʳ$2cJQsI ϫ8H7= z% za8{z Z*Z9ė wA/Z Ry6$J#K0isj8y/RL({ÆjS,n M/g U`ձ*ER,n[N:2kg+uX ]Λ Ih'(MH%>Y!81 ":3H`Ҭ sGl 7sb)Ψzf#Ѐf!001eq[b`=;ד:py4{_Ku?m5b?]N,iVt}S{, UEBdnte^A@,`0 HHX1P(Y'+A"AIBpI&'C&f_2"(}•* 'x<`<滯W:: eA=w̉ UZ>_dLIq@y`/tc0A„D}OOH*zIMq4 /9#䀛,2-@r?T)Q_PS99uP9f'yo\̶xvAzH+̉bwDGG?~b[^`f* ?sv@) DA V(1_eBF&zIh|N/kQQyv$6+*Tdxg?LJ=f!dRFXb 6e+{h"CX0LM>QŤPYw?yO~M䐍Uy3 M :60^vd&~7aE4ؕ1Әf:&= OvSx>s)ϿմeTᨵ~;+9I"$ƕ;;뮃N d%Z`CXܻa1oYqF̈wf_UKlk. 3(@bI#&'.q~:2~>{,!! i!Z7mD.Vw^7l7A%]Gu@= 3bmXB!ç얾6Jcۯ^slDd@a{Ikރo7S"Hf1Vڥ`8&9Yצqh-& ha@}oӸq/w, iI#h84-P퍙yA$3L\m+k4,H! rr eLƄHv7 &54# &E"Y(q`Dbw3C@hI.D "^D/qu\0r kLۅh,Z-t˅o@-Vl-B U?IvoCFW $k0XVa9Ĉá/F_Xf 1ϬFaE("~ )lQԨ9y{THUYN@f[e,ޏr6TL v 6MZ$M@EArȉ!p5}UmW~Q"k 0Dcm$c"Nx āĀ؀3k/v\&6Fc J?ǛcVP1HB/YZrd/(-! '1!_a;ȈAqscz oF47f l| ͡ 1jR jS[@{C\o~\x^ cb iy-*@l!ۃiGab]A2n=ܻ|*)fme6om-VBu{=) NFëfR K6HCe0 lCF4e/sV=Ds6zKaX #^p{ Ry8 ,x6'PR(-N+.&'%2BUX, rï1 v& Y.t #, 9;ݑ!@}I'?a$ezDZ|'@b` fv0=+E8[ZQI3+8q"|-Ͽcw8u\gCTg|/t>\Og- LJ {T/x\9 +\erܻDc"P40r8*ȥRQFe~1Y2Dbx>Pm]H (6"C'Ud ?5eU99=gpЊC?j(|OWP0QOUD^ I q8x"5"@"P8vv=^y{ ɓ91LOLp6?/y1o~5_  `,ɵug@^MQCCA@[jq BX>V'6sBu/__ҋQ,500mp 3xj`'iYQ(d\gA9dHR.@.==Ƹ70~>"8cZi5Oqd$g I t$1L\?}XA3 SQcrHJ 4rttKBĻ02 ʬf@IUk/G4W.qYll[~ r`1`]<{GFnH|0%o"AaF|DЀfK Ţx=.9i.V qj]a\T@Co1F"O7 :hMBMQ߾KJAE:4i`A"xn[`3Lh  xkդ?7=4X|dσ@{G @XbBؿ(%_ߖ/=cTk!1QVT?4M/ڟKZEYå"5ᏵgY`q {AЄC+D"W) J($}OSjwZ9gAW!BꒄAPÙI%FQĝs¨'A6= xR&f aǖkLc90ǂhFQ㛏/r>V,#1N5M)GɰR֭b=ŗA4^"ts"@E3L;oŁѱ14-bTժ{$Ø!XQ@@IW R)KX if125!1wa A0=C)0X/@u'{SiF)$7wLď9ikY΁Ͱ].`kM-{`jA$-O>R"op\74V.5,], ō*J+R0FL &xҵ߇X`, 1OpLAjLwrv*Cw28Rk\i3E2P]y1D;Tu_]e#<MN~%F|Oz7'ay6Ͱ ]\&)a$LnBmqkx[[@쨨410a1 X=*CGCxy[ 39=VM+D=~L8=U+QZ@@;hQ0TMP%h]@C2gD:<@ ]Ѡ=ҸN"""dD{M~<7'gÑ1c@+9|!@B_sl?U4 *i|UgQnZC.7&u wjz4("_U"K `+xo逋c QG5~>M4 &N/L%+1*_$6Ԯ7YMYЃ'G{Idmʙah+rz@ }H'4V헷=>iăq*OGZzSc٪ eĭ093TH+Fbmxk.#^! B?ǏIԻO%@hoXwuƲ88>6SRZ =, !@!2DooL8* _c׷ApdlYWv?Sw_9V`fO)+B޵0Nia=g twD{<ܦ<uВ<1M/CWTQB7ۄ)*0@"n|KWU@/ȹr?9G_ϏZ3;baZ*CPk>wޭf貂O8Q&=F3@ROoZK" uErc~khpΈG8WϸW1q!J_%HMh4dH`*H̸!B( ҩyn;zr2 nQ|Fw[d9[ (h H5\Fd/?A.aF&%:.(ˠuͮ V;c l̜HxrM(ฒdng5ޙ)<u2n,)0QO%ltx8!ɜ pd aahcԡj(.uԑ \ ykq`AO~-*:  XJw\021f}=M`sr:؄U4+_7#=U]T7  $76K\c6El96 ynXIZn;#2F`7F4ďiX&h0ZT֫dFE-~S}Dp=ćsz {@duASc&$Q[e}~Āi,۷dss'ee9IŹscJz54cPb-XѤN$+4' CjZaڹOqQB:?/iYQ}TqUԻj+; nyz+JF[.)ERSZ=0z7PXoZu(Y ty 쿛zX`jˉp" ƒ+e &#[kQ@f|}D;٠ H![ 8ݙ@`]ؐ8?Γw\+:T 0|o3:;u˚|{A"|EmM[m`[KKR($@Ό,t9ФI3L7qԼ$IG縄[,> ! o(>:t<WkNc0dΩ=U*u\@;Ԉood [ZHRI5ϛ[]]pY~װknw F 7!dI> OI)!Di-DƄfMJ4JD^bTI @JP~+~'cT0kS,W< "o&irٻ{\\Qd$\_i2 Њ#_fejc{vDPȃ1 WUJb>sR3 r˝HC.&b7>,KiI":׷'As9|Z*T}t9~>7a͎ \[(L!g?F!7;@YQ8ӨӽT׻2oq:zr=ׯhК8gˌy^/yXCz}_aXT5 72¢xɐ=א@W'}iя":M3ƐW2H 3 zB7_NġJH:U] m=ft)v@ŏ {?yj ZGЫ𗁊RXX_" ^Zy}E4ZDg~Ϋ5`g),2Ox9TWٱpk.b;DAH<E|L~7wƠ߲ ĀN;4<GbQ)^|67ѥxp}^^B Bc+ \G;zbeB22AUZŽ7$6`/?&i/8|Da$d$"Ho##ޱRȔ "+Y EĔJcYf À@%e+I#ôN(.k`DT#;5KْsW@߯!xGlng0Iw\ tI'AǙ(hp&ykߞopOkE+>EͲ!R7+XE6P4[kbi}]q?^<E!H>@:>?:Wuf/jFdshMۙ7o">`Xy^zDH P<@T3wsWA~$2"^@_h ϑ$*} ON>ʝgb;Q3jJ(_/?՞ށa@N)/]o{YW''cr~J:~(Xx{X掀<}1 ' ! oEuyb`19<9k/ /'KVw(*% rMyC^G4mCX;ShT\EgzMuLC%pz;Hv:}a<]1R\埪֒w*R;=w~u@ wpUhŃUP$\UlzEzva?*q=)P$ĨpdBʟ )阿uֳxyjKIjgsZ{cL=+2_ GT!̯x(W9C*P{\{hեp@nt]aV/3YmcHնEd$yhؘn6;ak1أ752lq8V ȄRaIAO.ENOʒ/ P(KQtmҎGPSQ4T=X`QA8!)QLlr5Lp5ճnht;:7N5]L[.@B i[b#:BN+hVP vڦ$WѬ!&~p9kCScʾHݦ~XPnkhA31Χy:VoT[±O^͢ާ [9D%\&]0掔Ö?k*Xŧk?tf(¥ꎐT ̉HlF/qo89 `ޅId+@Qe걩 " n` E27],Mn=vh hX+)TG|EhAGBc>ICl>~xҘ71]娖~4t+!pūYRU'5Ec8Z|H&^V>EWMmեjx֛FMܲd3^'_GY٥;lG*kzF)@b LB aQ$JAI<Ո;W$mPy>oK|oA5 3!@$.͙݃82~7 HǕz9uf=]#mg ?lG0|&d gӋ+ wAƇKlej̲۬_`#h\R851~;}#W:6K?օQ2RZț\0 L٧y-YL%S6lT9Rp> .جd+DQQ*^c3("Zf }JlO`ȽO>Р*l$ s`Y_jiDŽ !cAQZ$ OrI{mkt\ ԐUV65m$uM (Swk F͗u柸^4;qmyRM ۲>{x dQaɡ4ʪئ[;%B` hjF5Y NQǀzƽggߥX}7Hr䊏'gz|~U3y@q" ̗s5ȷ;9K,Ufr2 rp +'nK^mɢFw 0$-5;K}9Hu#F;wPrq?[5f \-wp,MFH=}9w`#l.ӐK'?y.lx rF 7̪S["t!5jp0UR+U?˫NQ~l6ZQMޙ\Hߣ>=q>9[ZlfU4,@W ?,j&nVm;yn{"ac:2Uɶ|j0vSn+&peU46UBumڵxV=a0|IMe:@{Wg^)aMLkսRAֽ1{Ja1NAZjQEKNpUXR%f eu2O&C/-^7e;I vC28ĝ9dK(?Ḽ 4.a{8С-9;E"g?n^%W ֋Y^̩mЪ5IOjNJ. eecJ|f߻.e5Mo->֙aH%Sw=uvi~\%}e .vl;2m6t7Mr +&Zu}Hc zrTpbF%7ZӨŠ~;[Mvi( d` xm;w.!IQg8,ɶ&ЄE 4Y E%$Lwh% Ṛ #)vl"BU@!!Ql~{QvjpWj_;+_!yܴ\8g9Z<ٯvr?8O_Eok駽..ťFt:r=Ja_j^ʌVF&j}Z&F\3lt{dx"$u .t0 z:V2 D6R 2T5$0 HB=lR؟ɫ3sPՅPLvi,Lwɘ i{u3"d MyFLj! WZ8֤6^-*I|Hj?sfmz^n@_l0n(@z*p3 D/.av1j_CB#/ߛ(Ebp8yT iT1AB֠~'@젂*b gMS3*"w{uGqƕǘ)L sj8imq&ü;]61Il!2B&d~að͚Z mGFAzZ(1:r GW]˜;gyDڋB9V]|«`$E$@6EpONgA/ie+Xd`~-!$'9$&E$& R"^o wő lB"z;ɣYW k3fؐFgB߀@C5 p"4`>YM `K`sv .7vfaaB \$!o>ǂG͘A5-S $@d}5ZZf"[y"k-c ł-)Q;&鐱[N)V@SA) E{aJ԰$Jk=YK<?GQK , u'`7ӆ4 *dJ)׋ M.dłmO)R@- cqd] [2|e-j tH6!VX\kUb^!H`eFa" M a. ʖВ"@]h~[U <*y;0 N"78j` $&,/5 =mkWvoQazHR;H`\`v06҈ID("!(%5f`izĂ%ѩ wVR7v%euvV"EO*ȆK!^f4bZ.,dL*Q CPCYZqP  )aL1G,8U^ D;)FcVj +5T8vpR55. 8wjge,a$;p2aMh<ʸ;Z ҘtBŞH ,r$(/-yJJ^.&2q@/ PmldBAD He0*4Bm>6W"X/BEEjiYAøiGTnVç6M ZHQS6x.K49^SH.Sz KaҀ0fM+rST(F` :)FQMTMe 4 ]IB/%zrw}}Bgv8*>[v2:ɟQoKmflen;꜖礽_{a\0ɏ8!}{)Z-PTPN!OKaO$dkBO|))hꧡ8QFViA1CkE {QbP=% GP\b30aza nŚHHPWűb_ẁ%P(fl"53ٲ1F/ }N6RgGWC9*Rj&p <4jFBo˰@lHܺƂpzJ $9eYJOH--Fk>ާTf5&,6_",ud"5*?zT2ѷΏ$]\K 3| (;|*<,{d{L+ {Qjg8!{!Bʴ$X`ΈנA  T5T,8wQTPbMiT6 h¯"x X`IO/|_ b.x%M)G52i="CҽnQV#ҥAH0iahE:4ك^D=zEhc28ݸTTk1 8ȜαKw`LFTZ(Qf)89K7?rApL 6P ҁ޲.⏇}ސ+"!Q֣9wدƚu窴$[Rbʴth} 9/6'S=BI j/QpWT]4[A_67;P0 N3+1jA1 2Iۮd8&U(p;5t]#5OkOkWSs/!<2Et)Y2s.7٩T>?x\#/1iYT Q"L@aW )^0lV""Q"@ cnm?~V}?PT3b QYjQOq}|A0l*8m-dP6 炀9UpL^ ͘ sGy ߾7tw7X I ED0`#1OOnǨg "HD&[ T%AT*\KO˪-~]}XwԒ&U%T$(EBN =l{$I?Tw_;2(fy:UI!/y%tr:P#h3iD ?X&;ooj wIG{=â@B" 0J  6sed|'uV`~OWtWt{>+>˔Є~/Bc|ȣ. gpCzcdޙKU%r֖ UQK]!/v֞¢ dfi*k2$|.Zf5>Gp@۵6ngFTQ8fbJ L tg e=@2 bdI{ۃimLt:,0,(X" a%#VDcx1MZ0g: 9fAʌz9gdo/ю2QiS E (~(C'Ȍ6A"mXE Tc. "x - /-"""I0+Z@ ' Xg ((G!4=ƳPD\XD d1OjapQPȳi0YFpQAz*MP3KΆ5CLP@r-8VR=TػmyQ(&\=qwҮ)g{EƖ7qV?3 L#EI;MAd(Z^׉6C룒\w-(fi(T#9ֱ+`!0YO~q#$]#M67Ű_e9w %zy0d$**@,:(A$-y(/U`|Gw?^GZ~;W UQm9Dn==tӗ_j;0~`#v:>Ei"~֏ERCL)PY=v>&[mwS,^T%&)b]Vh^3]i4j*@L ]~Ң|_"<_?)RAˮ&ҀҢz*[}81<"1ڃ#nÉ!hhѫ\+\ cWX>f݃A8Eu*J2fc.2̲X0b@f2q$ɏ9{d.vèx$2d@hL~3 VSʉ[qGq8~I i a?_ =fs %p 9$$N|lޛ'f`ݙhtkARli*>«gQw)d^H*5.͵uI5  a7N#iüBBHAx;^~W~YI7%G30}*=9)Ȋ%ϟPE_ֆwuYa2ai$ʱg ^358Say|챟ԟqWw. q^A2 8DIjaɚ375"f0o MK7Toa I,p@m,5x%G ^8fy dQWP{>_mnH K7:JȻBj]nLyb%R:Ź÷֋|Jԛjj^5 1 H6]gb 2x-Txѿޮ=5`3uj͵$kVC\ z|&T7܅ј?,>]um%ɘSW& 33= s~2/F0R7$:^՟6s)*72B!$"nwKt#}ppZCr _pMİn/Շç\jo2)F$gsDew_jљ5;74X ";68.Ǵ^?W??t剽?()0 2!hrZn"z.B_ }V6=ю :!Ґd?ٶT쯿Z r0 %p;P%ۮ9 \7shV6#QqyAJ" !9 z  #:0xhe$ `ϖ_E@YnŬbTd@L4ȼyŞq3#L Q Pf V3/90:ṕgY l(R(C] ٬ք%May-rH_6}~uL[ :С#hAhV}6 W{ˏ7iGk;\""B0$D4$}.<Lg|أe 9ka/r:-WfA$D!B80@xFahl4781Fc:d=8R< nf~ pQNXfwf( .1f`O TL/LFPOQEa^Hlm$_DjZsCHWG>l␙! ֭̈́u,3 xD<1*5mq;0JnMyUg.L-A]g${"Ƣ=^k\zVWD@@As$H $/P8{ߍ$d@Z[/bLIURB42CLZH}Lܝ!"$ Jd*a Wmf'N+k| -}g8aoߗXP܄X "b1K3L9Hf P&݊w[цma2٭ &HnO 80m* ]=/r?%6U?xW{ep_opp0 ]~flv`w˰{mε"1I:fqyL M썋H:+3[T}?wNǟl3gV΂mphӋKlQξɖ&E\v3lSoSǒkӶTӉ?V %n\$s)dt;P Oq5=^b훡-:W8e5b6ZA#ӨNȺa |IytwGһG'e*<%ː=y9);ޤ9i\[Hwf>+S!]x;t=JaN:Q= l .ffODlhώFv&HމeZr8_ګAgV֒ K0WKV]s9s%QP"U4EbIzӅRP1acEb )#79sqӝcI "]=cEc5\l?zZ^I 7>bWc4G}\׹]t7wxv.s=yNS@C ^R<^=C7j1m:8`v0fw)۹{3H# ~si5jhEZOgd[f qwl ,BpN@!!VB"߮Y|BAP3(`>Xo\-."Zmzmy?3\J긩] _^`D(䭥eoʿ^AO1d8ZS|ѓrwёSdjT<4.@!\`<ܲB_̯%qkcy e~_ ik:=9:]M-Ӄ諭Dǫ丒I\Lqw۸SAno:OogZ8')IR %B` Bx&ė1[Du9k$_@:DPn.wrpE11pC.V\( }>: Y0!ĝX6ilsXB5%cJXP>H0VO{`5gƺ gQ} #(VH 1V*eW&I`']5l d܆ٮf qbh6i?w]y"BTI;H@@Q Ow|~Zvd;8A/}# pR|ɘE-z ֨PSghV eDWj£3 `bcjEX8XE`9SH3L JLf29q\cZC$3ʬ:e{34< ?1 AUˌFH}sa g,Є5C8JPi@sHTi":A=sE6ԤIL;C$su0l0fV&Y:iGTJƑVzai ZM$as[фJKNh!g Wr*Rmv4#  վDb)EKXKhmK&vP"9KCTb 1؟lqvKV/ifuDv-+s8'poiĽaY\-M2FEH!]^h5p6Ra6•Jc)BKEmjZ/KԳS2LN[/ hU.ϙ3)Xp4ƚxTWQr]M-("Z%ɮhcNv{/3p3It /H"'+L4JCYI+G]O("v VH:=D 􊆈{`e@AB5MQR hY0,0 ]1(MfMC|_Gw8Ιt@wOGcCĘ'OMy{v8}Rܫ~/Jp `F8F1 "'D/Tg{+ĈAax5_%䤽yf$] C%G|*IQ3yHPI5:RC_'7YT> ?Yr&E4fe@Ǝ"?] R( F!P":W0C* NSRPxSCs'h%/8 _ QBg)vC!*ְ6Gke]a L0 | q\ru;0 c;UQ eVp$R/Hf9gxJm)"6Q5<-"Z5wyCnt̛%F*.Ug̺_i9.]+PӦ[I4&~k0P;gD @%tp(\pLi-08Λx nɶS+Wo0dcK!!T{a0n QDK6#|IO#Yre3"!L{;A΄,1l)E(3ë,Կ7L1:Y`@3d(Q d8V1!,3m3f*̐2 t¨T~ ݫ:61abeг6 bBo1 ^s4cQG~~;X@0L?W=Ё!#;7vQE2pޫ:a oD'.('N{ZH Hp9q,&,*]MՆeTfg8S)@E}t ub ڀ!aHTx(n1$[8M,0*YKzfk88y^vֺ D M= ˪a4 K3M 3<ZP]aqbQmRp4 2BXZ95;Pj"|a0m붒j`@,?GC8x.AEfbdu*dr@H!KS0] A~>LtvV,ؖnDBw5EZa+VҔi1bE@Lr(EkP(-RaWJF8+^zkQK4R%@XSBT ΒźWt @9&8Xh`ab Ez1\^|?!a7 $NפKS;c@a$ #Kc8A##ji&P^a:r#oM-|FW7j>@}J5S KZvڵj։4j^P+,13^߉XmUC{^0MXnhE!SqjboJP$@Zwl/Xz:4Y=PL^ўaXfƳ`TJ("l&r_ q*0XL5^- èlJzgA44W:'3H+hv{a{ ה P,c (lEMpˊSi*Qd'WT4_--QRE,S! QcS wUlZ|OQ0-{R]i0j51Su%Qcr>BpΗ)hscSU%?sPxvQhmIgMw,w_ŝp&yfl3UX&%BYvˑnG˶my/o}GG}=WaXg[Ɲ3?iZWMy h$0ĕ7، :?._T0M*sLt6կ ,IsFwKש̣P砀vEqW> mp:=|`SJ!~A#w˓S_䣖 BdJW+Hj dѶ u&_M@%&Rw]aQ$qC,g&CZҾn@Z=>9T8-:T,Q\*0bH ZƂgJX 1o*5OHf*ۊ4# 7̈́pmr57doy泿ɅY{3~K[_=Ӱd~Eރ۠؇ҢNxLHgk"_w-x ( u}9r$8po4?ν ceH|6>~rƈj>cѱJ"X)o}`3f'r?$7Xz± ;܏$&f9^(v[xW~.]>l]Ĉ}?Q[>>+>~9Z5}4뤇PtЮ/JJW;CnQ/w7¯4*#C*RtW3Ci),ES۲ ܈)/EU:#IxIħwUf 5I1Eh9Aj۟O}[sn \X]0@M0 kWsi :8&& Tpda9y̘^BmFB!+_]=e{[l7WUևK-xw S=zB)fֱLO}> ݤ"Omgv4 AK9z?qq5s,"T2OTb7g/X|Q$_Ӹ=DMGL áN7l ym]10Iו@~5|L0g^TQuHtVyK΀¯7(KY XeJ YƳ/UcwRMPOMְܡ=]%H!?UtBWPܹ<['zyZWYlĠbO=~۲;g/khcz7%W `Xd}AOɃW~ ^.|p5sG͙~\_q+4Q TFj ($29B/lݔքAޠ5­e/腘mkG)j~w]EhIۧSSDWhdQKkCIAnBКB*)o_2~_q6(?3ocBcEOHb'p"տϿN)`ٿݿ&;S 81(ڇ1;:p^Z`ÞZxg9$Ѿ_oD~q{6yYr鉇dM+="`O@Ag9GvS<ﴟ]tݗt^xJ}Æko dT!:BИBЫ*PPhWA t3!*7yֲKut1,ij%Mȴ]_P@ Eχq$6aGٸDe)S3sȹX+^-E] 849(\]_l5zOI|-Tj{W} $dg- +;OxS3ê+O |-RÏ359G2ՈA"-ѱ"XxњSXt5ӱQdgR0OO/͍=d,<2ȒQ"Oh[ uCOHO+KVګY8}%hqfT/D, ȅ8QmD &9 Ld$ va8 x&YLR増鿢;dzE(O@QϸѯHl˩Ggud,n5?.}59\O(o{qQa|)/vl~P+tM?1q3.jFHs4P&m…jT~y53#dyU*MT KaO>$ΫZXEjt/MxԠDdqz~ǰ)rǝ ayj/QX=xnt^靾WA2waL $?yC~K oˢbhG|BA'+Cf!Q|ziAodoB/?t< ތǶqo௅{ 4g ;4HFD?nb#9qX]zkc'n~g΀n!FȠqfw*czm禫hOU;duV3O% 9h{voG_ڇϞP^"`g1"gT/եE]2M"KtBDJWPҭ4GG \u(n U N0' e-Zpņz2Qų[d t 5ֲdQtXjƅ@ y]Ѕ-jbf8|d{nQؚG|_ N?gԠ:%} Na$i8)!J3QZKs)@3pjGQ E^:AJl/r\V#0MH=>np:95leDrɳ|KY60ׅ˔0܅y _8 y&1\EKNҢԬ:cAvE;]j㈾{a)!,_Lقq!B>$j/a0AR3Z=Yrw9k-T ':> (ն~߃*\+_ɨ`؞I9 xu\嫇m\jjB+1J zGDS˯:d(C;}X=v|O5| N"߃BE^ʹvUE4t xNј|Gؔ | Ez>]nj_}nvۣIS\lMĹ|BO=+{eĪ:ψ̤HA_xR><g6B)%pe>ovI4moI Io½^P>P%"/в g[[_sn 6÷ nbiKx9z9U:vmŎ)Wx>_랹'=*ގt8g y$ܦWʆCzһmpFݷǵJkRR]h|xawvS8aͥq SD?FZ|SLD԰Nvv+ bX֝u8(lmVJ~Ueb34%AY7fwh$7bwk<[*8pǸfVdΪ _ qU\rx!eN|-$iu2kSwm)Eŭ;!.[P]I;^E*bO! 46jjHlXi\5 4u3&$SL;ID/O+'ULb ]gj!;IJYGr\4l{O9-C<뭣C:<8a7@a9݋2=-a`0FX@aggKak1TQL1`Wiv?"n{J"kԧ1ii0cLG2? ڽFo|tǴ2Ys5*h64mS(s)kXN3٬ pfŃf2k=PoM`4q_We7 噎]seEMvixTi4q۶G^\4[ tDWOGtw?)f;c1>[*gz9;ٜs2|Kow [ AY٥U|y Cy, M#hRl&f$ xrD Ad E!xG4Xn#/ߵ}n:~Α'|=sk1V ~L.Hf>:`co?sc?jm'y=mMžziW\w9ú$RO]'DFp`~%?ERQPLP88m`: HS]>B?dr=]~;7 V- `$_yeڇUD 9PPGOxW8  ?7Ց_> ?ZDr5B&l"y ȇ/_u_/vD?{XmĀNH@}}C=^qxˋMVK5zȁW)CBdqʊ#{UV"X?}Ls1Urp?$Q5_oB˥ ᢟ~; ?r*/Y̅jOkKDx7K?5{'Gsc@ zz!Z S7>);x| OSpR#ʲ<<ಉjD{E濗:~l?/\-P; 8*~Ѐ萀QBp"OfwàOyدm =wo|lYfY]_[.us!C A) LE/"sfr}VT{L~Z@ ~Gmݮ9؈{/q;Ȧp*?Hj?K?G`ԥ 0 ptQP3\]up|_؂ۋ}ᥭ*~+ ,!̵08C2 >B1tB{`Td~NWͷCqH:0]`H`͈ZftfHCDPc~'ti"e7~&~XN)@quX~NZ N&.R)xcF(KJ'ba6Nftr$zbIz#;O9[\JtyY >{OýrL8G1qMq AWV쬻">YA6qRo*@7_p ~73p|%" $1 3Z=MR@[;H_&:].IqT/ލUDXA~;S;*쇙 ]g3* RPEqܠuK((Hs3̫O>N]̒ qVCrSafx#IC~o?I,B)s{B?bȟ Q| L'm˩~(w뭏#|=!eXUQܨʀ|{w |fw;]w:~g[{@zl*"TO۬[;(tGx_iQO|P:84 |"|MfcT7|#c} Cg%:uj$! HmAZuz ";MJi)(Xܩl;`*cL 2>Rt9ziJ6ߖr/TcI/~}9S8!_,e"'_ !/BK냇*=U۷9eZJNP93NuW_M26i>cy=W w+!9QV4y\)EfaP!-YN)I+h8+=|b ϨgQôA* bpSpiYi1(AR7;_q@wj{฾'ɌŠԏT|5>gg-PE?O#S٢{+՚7 zO ޲ѯU$κɐ1Vo'cT2U¯V$!kÿPw, N[OmR_GM%T} `,3Q_Op{SN ]~:A>w͎{ƤFIi71~ ߛWͺpD}^}oOqzADK Dj&눿@ߟYߠ1}V.n&o9dQU0U:$I댧控}^ǟ?a)4b_XUw4)0DR᣿ozĽNS 7,8i&L_~9@J`G; ejY.E}kM&GSfz5} FAKw}GT۾>1LGȑBϻLw$cb>.n|aol'Vr W!GWm( KWгCgGoIc?y{S/"N$VyQADS\a"R PdyU;aً|.Jrf(}-/y Ii0&Y96ԅXepL/Lc8C/ PFͱ[<]E?Zf J::^ZQ'ξ,mSmZ/M죽CzϾa%BNe?y!>%.vh9K'ʗ B{-:-+y2mESD|U,$r뺽dx>/Ə9vv_Gs_^|kD7B}Sp<u\`(athWyS"e-vTZ0Qc ohsbS>jXsd3"WxГFUA-%mNjdQWj;IRYQ߰OA!=1(NDh"W,o-=]8t,k_|b`ۛ MsIT9ft<^GksCQq) ֧۞h۔8|0)Ig9imr^ATɰ"\q8$߿arֻ\{2ۂ G@ G~ C!nAEBP1A(Kf*|Rpf;L40[=ESͭ9 Q"p8eL,b#^4بSC;ښcl0DH\}̈]$>t $S$Gۘ7ڥZ0rkҡBd{K$D0~6RBiJ[EMk$3Hi]V$Q#`ZXPhX=F&iSbS  c, ʟchQ1Rl.cOуɷdJiGV4/ǫ6ptZ|,o+~!A{|Lo{Zo=lX2>I\2#Y?Դ]P+@0:/7ɮg'd)ʖ+>%|? MPd\FEî ,Tud''v3 阮T\c*{57SQ3Y'Ѣ2PQW$fַ-6Nm@n "8rE!К ѥ83AMLR,z*"N3[f`ڣGuOz&:wM=P8z=( `Ӭ]? N@7ygI\+_{9E& , >OQūZJ8|?u<⻋+%朦NӢXғ$ tWpx8-( *JydnM?7 ;&]1jʥ }L!*Ճ]9:HtiJM%kQ~rhMʝn oM[Ͽš\{F'7ZH Am.T=s"hڍ_LjǵUD.[e[]PMt(',=LqrUuGŚm?ko-P^.+oNa=0}Yhå]*8{؝XCtɒ>)_B)vTu'eAN,EO{{X0 L5 9Uą,aU HؼJFJK0F+~P<䓏`SoFژHLb1ZNŋ-^dr{Ƿkcڡ Fڿ ڴdHʟ|؝ ПR*'g[ 66h(3J%n"߅7MYYxҕ0+R;ތHsJ+"u(faGrI,[wIy|)3jw}*GL&)Yo˓>F> :Hx'S>jlBIF6 +Bo^=͵{aX=z t2AU*,~jt9Vn}/IJ/3D9€ #ok9 Q8بq})APeR z@0iA=}]ub*xxB9HY/'?pՈsw?_fsM-33=7g8kD>owgMEC >GWb>̀>"gxP.(lCuॹBaPH"B8Ӈ3HkhjY8{z~vnfg0T5'P _5qz|>8ϏGGRIՐ ^\9?s5dQ}%v^^W//x\XzJAؚ ]i;|RvJd4' & HH!Xi)l!!3e ?QJ*Zz~t 8쮇0cu{_}>z8Ut]\8S`Gk>mjVT;`ɉuD(H5+;R>#(dE9:r gcR b@ uR A؛9?T2w;fE( X.nPgK>o`7CDj'؊iS3S74:pghQ.MW6W PY2}GlF4my ֮V8 d)M|y@}黇1T#Xݏ8eG2fz<$5fTV@pgqPOKVwi@8q e`sfX@bw f$tg>W! |kj-C xy*-(cQcD@D_@7P'3ڨI;! &Q<~ڑ?r:༬1Ϳ;>+w7oLblX@O:%"$ΥNj!]H w@0BO>T=osyTk<}(5_ӓ#DEyb8׉Jܵ_sBDs'->1t:‡]WGG"HonL:9؀vbGN?VHr砞% K)h? m=}#@}(K PBEiqwmdh'g}vt'VZ;n?|O+zkp(n] 0G U>t #Pv+@렅&.s;8EOj=+WM٦l>>oO#`2mrCA_=Gd` IƊ'W^7TBgw!ܻ}!1KWaj?}Ou7w߀DMRYWl}!8Ng7C˭ H3BC&$G$@=_t@=ws:+Pwu\ſ0?8c3"!(F,CeQ*i'S߯|ZCnM}+Jil$.ѼfG9Uem=mcof J@&(?m͊GPC)lPY\ Z_52n]mv~;|P0r۽U٠kSHe&x/&D!z'4)QyB(h`N;nv_*fSG5 }oB'ק\]w+ƕ_ˁl͗ʂ m,)Ŋ(J?kjҤ8Mu9uIFK!VGKEgP/7ړ)GzຮvR'Uw{=4<Ru)PzoS0](/E7z‰YB?8/R 'XE0ECgѻ.rg{5y!x~迩#\_0~mfT =t#4oKan8J*0sU!ɺ?>&\Kw͝@ndSK7N嫿8bgf$07/"&HMV_7C)t[xiNP.p#|kc8 "s Fݸ;a! R;C K80؄Lkٓ JLl`~ZCR}a.C*4 dBFvś{Z.\ xܬjPUyRyIzrp$~:ړ__WgSqh~.CNw AF">jyv//\tѹҬaHJiЕ]UBP$y9?栽KeTW+TYث+rQ骼2s({gܾuc%Pfך*ĮX.v3JmH*y[*U0'otx@sp*nY$ "I.,m UIwv61QՇvՑxyJ^4/ Vam `M{/@kFPO&l[󝻸iiHL>^:c0tψaʝ8I'L7"╘gk"dWy?Y{A«o{Rb5tظ:sP~gz޸D]#KL7BtS*xԡswo[SBY*.O0otw=$Mϋ-Dž~z-6Zu"ك:A K^gc 9Y0Fclђ-وj|rW(J?H8d޸HVUGiXrEHj谼?VƎ, 3$ވrßl2w>|{(tus:6!=[ڷUDoV892??e%eEhZ90>G <'_Tvp1!#8Kg$?,>YI]5*@!DO: Pk6-2ϝ%`.]Q')ibN L3|Not&&7|.72O4OHIt(bcM  ڂaX \O=Ʌaq.+*0W-v5pv@Qr)ܪg$*u&8=mqO^ |2J;ժu[\5L5,,ߥ$&k16s{zYm~עu| D$Aӗmvpz@ ?쿷{;#__q-wkXI)_c.\?q_G> _v}vҋ3@hh?_L~fWbLq5K{hdi}8O6?N;~F._p^6*A <#H~Oo3c^ҕPBw[a W2gwf.>_K'4h4EI]ݦဖ e#ٳ?\GCo{8iSԃ`?s5/ŧǝ:udkARD yocq0$ 1!EUU_HfNIjRf!7xnA{{7n m;OK+̈́e%`1m逸zx7%!1ܹSZ _|Mt<9_;r\}ϧ|x!*Vg(~Bvӧ4/O kDޘpsTu+V\+F6Z>f+œ2ݏ\oApfR|˔>\ oz]!^/prڗ] ~r׀@F"RlWw[C8>Sr(ŋAQ@X؅kRR[F$T<We@}#"q\/h0DjwTִ:ϣ9ѱ޿FGV8 ubC 0a&)MT!V=Ap?L_ czsK~ ;?y~;@#n*5.?=JjܭȎ[ӂ˕<9+&(HK{ix?WZ7ܑ9y^iM(3`ba:` wkt|%LZaGnΈuBדo}|I~)`9~=W<~rۊWS{, ;kuC_dTDOÐfFd@ekmMF8i(̦0 8^CEwsD p XO}w^d`/ӂnn"'k+GYL_*jiO' b7]{\V?3YM3tD"aM@D,P&oN 6 h8] gi($@2[F`B|u=p}ne䢝6p0;K: _60 $>qkRߒx/_B6 J_rWttb&/0HB#%$'"8sӭڢ ׸&tBz6VN}_W׃d= ~_T8l@Yt`S l:^'y^Z+g@{ :@ݔ'T ՑPeS@P 1~:x}(]%8L^ϕxZ(Ą/њ1l!=#a'&|J>6՝BK% X]_EWwaýy7o&c>~Ke-@&HCyWJ@EzO) D4=WθN b@%7] <{U"C( ?*.3tJ;=gs6z/}#U1wO>S~^>7 YgNb/"R Tۧ(u\YW׏ŽdI߮N+#%Y}yyuXۣ'@;Eu]C fϭp" C2|-G/ILo^[k|.BY|gUJyчW8سf7MZO)v.-K0rZYr:j.L$k/N:,@Hh&zxf\4HxZ 6Џ}N_Rq><]8y>2M FAiG䁱_Jmm:H1=d8PC/x{"ݞuHBJaA2[ diHo捻]e$oO0X*V]9r~IQ˞Raw_ݹ ν۳lFe? *™i(c[W'=_.-}[N_ΚOD~8Oy3 9)wƏt.E|%zjιBUl eF?6Ldɕ0;<4}XeӒ{>ZSܝyP}^˥TbvfU bpIF'>d_n bXG-.ft1PN$VQq򏓡x*?))ƽ7932a1'6Zg^^>s}mjFF1 *%?L|{yv\׌W&Qs_kDQ)3r\8 cSuaCZlթ=;˝ }G#H?u}U}5zQFSLXXAd&;nKKfHhZ?K[!}_3n V?ѹ]Op0 s=YuM=K_<-(&׵S~KΌʝ ~6-$#PcI=;tACULwJrԾ8!ʄg 36nHk8xgEyҚk;ܚ(>`/m􈒶1knҟRsۘQ& /TFj 3 ;3λ(/2Λ+(؞GfYvJ`[0Ǩ') :~>lohl1vAˇL%JpCO3Kcn},:V﫭`o >*LT)~//=?x [olT)]ko,MIA -՚D&" I܉ե"Iϋ!ykPlg0pΒ|S RQњQ:sJMpAk4I0_%m[f c]hd:gzޢGĆ1츌aJ?+;F[Ra@<⿶u6Aʶb[PYSo{_3#L "dȫAt:XmAgbܜSh;XNJb)Yk{7Gz7ٳ+XՆi\2;s D8:,< W^y OG_nZyS%Q$Ep) #戴aa_}Sv|K$7AB.vJY'FziLKL'WUg&PٔQ;rMK:RFb?[VKо3gz5 >;DWn3M>-#"VSVZ0Fj Xw%yhU?\2}3}Lh }}hpYYLmHN/Jx54Nagv @`&C+>դ̉y2z?R@M6'y"?{TȂm(jCOjz Vxw_sS[>'^{G(@AG[ )Y=r;\3.2vU.!F*Bs/,s/l4 V@:Y4 h%{Ϗ 8f໋ju,t=1Մۯˬ M>"|uU4&FK WMcCw|k:b-_)NPt;n>îBP=xJN٢񦄈\J|>ǂ>dBub !4" Bp"{$QvbOeeϻ{_Gjc,'Ϸ37\:$@@IJP D6eJ]J w*$ 6>Mڟ~&y5x@Td:PsZz S&gNLUWP=F\y[Jr.L$@H8 m~?n^u8qmR=~,=BX#&xpu?#OO[N\݋ʦ0؜ = 8u-b3y$-= _S2 Ɲg4 m!aX"@TBl l~\m?U(₸j{?}K5 sZ؝5ZpPԆGxx؁D>OOaxy_﷫suK{SP=hR A=|!CT pu^j'f? }D=_37Y>l"z/N{<\N*(pmF|E[8 Ja|&(lp$wߟt{!\_<6dm  >,$gYHTM /߻d7/)-u-s@6f9 #$3TP`lE>LtDؔ $Èv7Hn@(P/zl ؅Tx58ړiI> i[D\efyzxZ?/}Apj]CfazϹ b*|M+3F6LF1DB11a׻8CQRjK%Qh2W*w^Nj+ij}GGɪ/br![pԲf>j6KU>;!w)|ul{=ڜ}p)w HX|Y"$\E DLzn޿s>tvHw+}7?dTcLf`,iaU {5KK4[tv  6a w5M*kfn%GJ41 sR^'Ukz&9mf|c5NOCڠByDT($gD @ ?4N:^J v< BqJm†Wd۟0K-Pk|t@?04o395Q1!-y3T]?$ 695*.uZ^q@:"V(0 0V{ہ;~g~G@d=V8WLN)mBcӃLC)o[sPؔ޲L4vBHO8Ii({7âB`>;c#T,p&#O\G30<(S !ƛNSb6{mSr!e;08 3Ţ(+dIG6ϰltBoS_nڞ&9  .k.4^kH/xP|񼨲"2S!$H]tUE@iY3vE l\_);n 7g3M;KZB<Dqqlޓ'cMer@zo#wߪk4>ZÚECHuPuFBH3Nz'J\ea hHmBxb ]ngG TM6-0;:|d{/ZUF,|  lgO0AG}֐e" v&1:e3ɰ$וE;^6uV ][u(ۖqT2@kUDŽ@ncC $"u}%Cpf'|22S#u.S_mKD̝Or{6~ox^Y=Z?8?uNlToPg|%LdU縡\$L@ bC\M @>XُX_ ~lbVW܈*؆o⡦$92(q<% ~C9>5{vEYhκ=vۂ4%!jM~R}OoUT?cQX(1Zqb]ьRzg*dǶ( IˉcS iBe3팗 u/I21Gew/I |ƿt61:nQoʟ=Ș+ӧ$ՇbIGԏ7Z}w3Ȅ) ??I Q=8;x_LkQ~u^jXn >X9yov(Piv-XFH0,x ˆ>.Mdsa'gRRYSiV."| Wpݚ[.;/7i7 rcކS  ,G!Xbxn`;&| >E b=Gn+J95[kdGFe{QQV߸76>,BK~'6 {>BO|㛒) 7~rL2ĴiQ(ܶ@SJp 2pL{Uh$yRu)8 3^};oirmK.UP`;!]&uG?5?>Š9ddð,280,r(F9kЖdJiegʆ-}p!$xl>}y u6O*ڌKwr+~vEBb~IFy`>~z^~VDs@QDŽu@܌}T%۩` 0vo7")G\iE8foA~+zǘAS b>}ݶ5Ԧo5p|^Еř_baŚg'PVIo ho1nuZktOGrX"Jd&cB49 2/_rBDԡK|% ݉{ٔ2<}6,KG!t{ !d|0ea>86UF(i~?/ɵnoT ZgC AU) ɧBf VfRZL{o W>[ !/iA4׽F C1<έBpnuh5tBs)2h$S.ܹ.'`0[=u s)-T/({#3AKK7` @H ~>NHw8GᖗD@2_'XcmF  ЃzP' x̦gٔ>!<462㈸mVen~v_޸{qRoabW ҠnrUw}ŌO( 9O`'/ 693D\dGɢ@]O,Wxˀ>rQ&Vbx+/9cēB/ -:4ωK1ya%6nz[ks7 ĺ/)o˼zQ&)kQ|7R|0L‡dd."EHɺo XrEF_&|bouE6{Ch+h;CٍB L.Ғ"zF7]8pGɺ_v//- jqw)lHweQ2[@bHx w+'/Ёfx3cFPZ""[Etø rʒӂG%908~O ) MBUom4SȦ3˨ID/MӒ 8MIs&c烒cރWϐMG(Cux{O1 '97rْ  P^kvߥ/!RRB\Z; DDvUͧVi.VC(S^!v0vc"ߖ?r&{xbHDđ(z=g!\Ҡ_TwϊvwH~^Y²<+N](0-4-V}sT+O4bsUeh!RR8N{ ƆW\!c 9ÐaA?PVqi4ڲ9$J/<YࢍmM+쿰j *흼1]M)=II0BRii+_# :2&^~G3e 6oˇDrRwxX{'#99 LxId\^Dzѧ=mҵh2J+CWٜ:AAB=O=+{uzLu=T[rz*] k? z LH`ݘF ?[574s=dDZ "^!"uP>w'~_fCEbWsNK>g_V'umXPst  ? 9@DJ-5Jۼ'9=ñGݝLP4zD^>}jiz %e\J5;g.L_c8n~_\:q6llTT(nx# ҾbAܭіWe#N%ADd(PEMW T Kl5@CC8hIyNlx4)yox5B p>tLBVR`$%6C;˴iu2ΧV:6,әnrÝw~X۷t_!!IOel 0VȬj N$Xhݝ N{ kE^G|nХ׹-ӗ&ߌ;" ~ 3> U-Gt& /PI8?nʾݏX6Nߖf;7kTinndECˋ}{rOfͰM2("(&VXETw{՗x ,m":p@׫BmFEO<Bnӄ5wj#ye3{VuttO>\nJ4Hq_5~UNny>Gܫ>|;6wc՟!}o}(|_ 1$WG[߫ 3߽_6z^D[tEd JsyT:U^6v]4)H{?{Y"; xJ"x $y!\m yx< ekҾ5UAZ_AӺOؿ+gӛ9ً*HǷ+ڳ\ʹ/mZB8[EzndGz eN FhNyS%NW4L+jI= +K|ȻJvNZ&`;ӒCzNzpJ yj3 y1H|>a5E/'y(m)ʛ/ѦF~Ueo<*ΞX˼`(}ι:rONdץs_:Q[0vZFm tKӉ!Ep;WVȵ4x5++]&oXu^xPׁ̭U^ Q! n9Bߐ]q4cTRiՋW{j\2Lgk:`A ;t)u7!b) DuI/r@U7N,0[Izd}7U$9b`{Pm:"Hq!g֙˅ !iJtzzGp/fNls#ᒝ}E0m 4.$އ:T wTB;Gd(kY!&B=CI"3璇g:4M5MQ[}WjO {Q l(ˮPH6s2-LD nvyTc:]h(Imv?J D+#yNZ$Foy gEa (ASHUdpX^"l>=q?x% 4K2kWUZ8E3xOK^ O+_t>NL\wXNæ2#f*Ogןz;(p 5wp_?EdpFl:M_* 7}ch xژ}7}o+^scWlkX+?-O+I%p|ZB;Mu89漁%YOԲA d@֍ԛ os:a(YK"i X7%C=~:Υl/gif4ԕ|*k*31hxIE]ћ Z~ޯE/KnZxOpEQ&A^ئv_'wo :)h e{UX|TN|~6kM] mRLt>{Qh:3a[޽GL$q_iQG8rZ3yUW<+ezDS=yİ у\( ]Q?)_~)W{`ȕ5LbNTzќգ$쟡=3Jle*svSJ*D50-3٪Ό֡ı OP84N]Y1cO/Ez:#YH[uFN p)ޤr&Qv #-ѠU{OZ 'ԩRIqi/e[ H7 SFNsj*mH^NKvIp#=WfɄK óN"!`s$C&̕ʈ٢~??KIFh;ȿB?M)IZ:G Nx֕Gd\91 [{Շ t QKv_"x&-*fWֺJݚ 5 =DkguT B6_wӦVE-W޿87k$ aGL J 9ʨLxC]sERrjTzD|| ?Ntrע7Ŏf= "qO$Vwx&}u PMx9S+Ew# !ƛ{LyĜgF7]j&0BR ̡슋/LTzKEwuUGtC( wrۛ\ +7*8iXVqrY:XqJÜM m2>Ϥ_[Vu?hݪ3̀ C9F5ɬ^oGZ9%ޕog hT`5fn_ bQ#< yL!r!>(mεY/i#Mvqm!>M`0$_v}_%߳:()G/0VrPR|Ry܄>yXSÒ6O1oY0 naj ll7z݇A'ޟ>΋A`F$yA2,hLB5Jp@)8ν[.?{T|ǥu[y'V/T 3a>>o]YVG,㺸 8^N{ g,pϏTI IO޾=-r3և[\~SW_+hcoV%0'V`2ci]KGqva/lN"L;&VzͫGș _) ;O'熾pwڣzQ~`uxRJL9{Vǝ.hbCsƘ\=O\E;H:(떔J9C+8 CԩG&W/\Mj;Z??]J HE$'يۣ@^R R茌h ~tg\&yOK,%ޠR X/<*4~A+:]޻^SdvgkL ` YBlAW% ɍ ROUx!}M;! PR\us'U=M&$ z#UKD;0!Ϡ|X,?LU$!`Mv[I  Mz1#vbdPT!]+*Mvq'@6dP d} 'u/r~8zKxdkwuuY [g{!Ї&{6\`#fhĈoD4yA؁/D- L$PTs3%&L8b:c~^QQ 7: 0l GI}_ja!DgK~.t=8aZ@a^6 } =7f5RJ3nƤS} D;.1@6*5PWG27r$29/8_&DAaMN"1 %4sp1-Dj$j!29“^X Ϫ` 62\2yP-G}lX' GIlی6m]{kzh;iA|KBv t$HBpCmk#w1Ѵt61_GRzL=ҿ<>3j/~}7]wS}<_'o;_&4UOUX#O-=i 8nCWAvՎgVAD#j=ITj=Y)Uxney-YBmU82'G@-xf#5 Z^̺\oeL*}NL%-'xb ?\2~|d5\ͯ2?SMЪ_kK7ZN5O#w}F4,FmzZ(ghSB^[|ÎB6%zTZ#v rg(S?->MFW& hZ؇&W~ݤrFCјG3K;tG9]Pwz3t sqPNگls?[zqȳܖ5K\-ȱn p_`I&DK&w|.o_m5.2Z/jB R?'w~#'it_;2'g\3o͈?O«YMEz#EɈXS C/e+7u*p7KYgyӍ34L '@+"_E7*`p$^}DuqǍ a& =yM2_%|96{p=]}ͺno(a*g+Ć$bBv8 $"K7-\M#%Fa!+ f+)OnǒAQ0f]Vܭd79D=Jmʰ2B51KH}0-  *^;g9_ D^#|䧹O *Z金Ex-/co_F}+;Gsc?#2yJLB'z(:>%ivAY9יǏJ=4!KaͶЗBiߗu#%= AT%y,aJʉb>|Q_חrW]GK+cuQQ\889lD Y~͞屮l}΁Bfl5aq;vG_%*r+E7%v/ޑ hCY6_JwAbB\/,B#>]6m$Z"2qA gjue|v)Pv XA,V{Y*{T>8KE=!s`0\pJgE)9ѾT`x&K53G %fo~qfB:dR5gSJSgUER!^1zkUǸ]!_#x;,bW}ufz gHMB^9X+'YVmo  >﨡 _z#(fyTgSWD+w{4]s=k)u-?@yI(ZbF.eU)qY%E\a}}+4&dy(m7/]ޣD}qxL:ѭAc8?.wmϢZZ.8J36P^rt0MyXDق,Lq.Hx$m~tܮ_΀m ,bΕWbI}̉V9E!P%g&כ=CG%'{yU9ߤ B*"E̎B z]l3N!BW 7R xA]@F?Vw}Y I*Ӷhxś{ ?%Pƌ *ԕ UV_Fƭ{B+hx=kc5E" ~O ^x+K@AI84>)F%' a<B'd@6jt0mpi:Zt<'NΤ!ηּ˻Ӄ];*|rx!h\R |H?W?Q"2=oYM4|e$sL3"8- f»*yΉtNux:$|w%*!$ *jefƥk6ן%^MR%&uV,rDDA\}1W{{<XrB̄8V?ҍ'n_db/6Mzw̓O aX}QlAV.jwyoݤ SZm,֖* y]P<l' +\ѳgr+3c{B|HVr8P`1!g>&;Fh`j M3='}{~Ɩə+eC43]5r[_'G#q?ͨjٶd٫2zg|8ZGn:SVP7yH>P]!$x dq pgAEz3B=?G< 2#Eb_Ax :DC N~޾'^qGb ]J%GUbקygvxHoLԒ£e~0݌]n-S;N^.TCy=؎oXv.)`6ge8Q~Ipqܾڳ̨8&u]sV| e9QB$+:`<'B)=>GU@It^ACͺ.V%pLQwQAY뮧F*>*q*vN6LBq)?J|-G:N2 7UWI)i5I%mt_my n[ G>_(pyHB#MQkV1X2Ψ38?*]7 *Q̉P_?D5ۦ!oE #`xؘ}Cc;sC]4r2Ulm_&JO?]ա!MiBo$OK!&`2cY7W2]JFU{gg#J0`aM7z$~sâ:%(#-k/iCEk":_:ԓ8o9}+M<4a HD *;82Bepv8 P+NvsW[:r2Ĥba%WLruMexe/g?nlz){2nvP G!I<ϭ4D+P+˕p2kjyטr4TW)U)JZ?S4{ܖx8.%Cf`#=޳8sM2 b$<F"*EB &Ոw;ϋ8~*g?bB#<9 wvjmK1(t.-?~ztsU <=zȻӆk?@ O7 vopN'2)+*rn^F/~n//>q&sAn ta9uQnMҹǨ㗣}ˣn>tOaBGTSr"DxObq]|nlܾCV*˼^$IΞ569lWJWdXFFbDM6.x*d0 ԛ(<'Gst='7*hFIEҊAWCkQTxnŎKOKFkTqIy5.mN\ z~BK:eOttN~őۦ'^E+dg&aqrLlgsvЙEcw,)e䇃5. TO39 Jq!Gs\ 6q)*;=/Q*d>&u`ƥk?G2lAJ>)jSzޥ;ҀwۍyQ7=mHF&(ouո5|yl%ZB!B9GޗT< Q \گ|ŇNSGSC9 WY堗!-d,h@)d@~{AeMbZL7zxd pBW8ȕꖔ a=J3չG.=ƚИ7kt V˸G%~M'8H Ǽ42JELUnGGRnnOI|ߛC[wYlǧ $a!Ƅ|c˃}OY8V;HKfylwh_O)$sS '(ntYOk=n^jtL 9M\ @V T݊5ᦃy ǿˮyOtẐ4978kh BN["zY'lokO>Hgڀl!.bt?(`mGJcnr)ig=qj,UQ..afkr_/W:./\_X8?Yxeqޞ۾e:_]$܆WGx:AٷƄY͜%|ؑ| ?Zh9M4s7g4[%w~rB=_WѭSb7lcxZ_Bpu <8W)}^k_Z^j3ZuUnюx03Xjg :7rՋҾKFiʎ՘ZKtHqIw!wT o%|rnJͱč=WT3"UxH&p-І+.9%jG?p]Y/0>ˢN2"~*`cle%SesLk}p``KML`DuWg"5yb0sYb̰nRzGLM4$%yBTu]Ówc̜!h'l\{b,q%r $kaN {/C=0W Td5fpfގ\O"JP l$$bz/=0p(g#y@! ?H 1wJfwCHpRpm |Q9 `<1 SDuźq]1q~|cP@ٖoi2aa}: Y-B3ʃel&ю z \${?CX 6Lye F[XA8\Ģ{`qm84X7 Ogѵ.K+10nv,M:T@>϶<h'!h$W5~731qn;-B+OA0'v)ۤDF*6E)F{pFp65w#|y][(^Rĕ;,}&XMv'PYcPJV;: |=E΄/Wڿ?@߼& ܤrIs:y ss>F~̰6elz%8Y֦̍BRuYvC3(UQ"j 'þ@íj ^pjbs"أ&Gi8'hMځ^Hϕ]Lu z 2 c. _ps[U :'ΛlY1SWcG@? kog/_타s5 ޔ 36`TIsfy$CN?=>o@;|ِw5Y9b+`q A誠T[0#kE=}ny1C誋/X7jeSF  D*ٯlk(}TOՠ@;QC}>Wmq SW;qTlo*:6غQ'/EnO{~+vm!b%?j76 l¨Yt*NGB@_ Js[*rJD&8""TEP>]cm7tRE ܡ2&GD)QU_9"$W( kC,fdĺ֧/$c{1o ))!k^;%j[JaCS}?:g_|.ᦻuɋ-U %[&_;fmʸWt1T&_Sj,LlQ%ړ67}pMБ[5dU;_4y~5Z&CʉHw d$39jK]Pcw$JƭklhcwMwb[G\i%LJ>$|iCG|_dp)c8;8vثuqOlIep%pL8ɖGF>RqǷǁNLUliЄ;fKQ<OoEWLɼ]}/cyr`kMāQ֭LJ:~k/%nUTSUdclm%yTXs E`oL) d! ? :YqH!qhtRM@zLY}꜓v!dL쟷.2<,?{F=71&VEc\w`lWҽ\3\O !KT}[}m+وoٺ9 upw_ .^_|6xWyJr)lNAvHqya:M3K@ш{ Oh:c駓)Xޫ;(-݄ƍhK*4e4iѯ;{8iGǕ{gf`,_"V#nw_/%A/ot R'zI e y҉# }t uWQrZX˲EhlePUY/;Ӌ1Sw_QAHZs?Ο>[W~"K|tE|偅H& %Qk؋I3Y:H2Q2n3(=/A{U~rme%jatcf:_֟5zKX[^?!\hht7x _Y1LC*5^M~/9ăQhs? tSc҄o<~=t!s |^`V6 {0DI!2OdܰSΖeiΩI Y`C3E2_-A1dŒtdOniU 8s{]|y-N2}{aWvUqv| r")%Di.1ҎTnĝD~Z~Gw93[_8RHz@ȌCG']A{DalQQن(` :;v0Q_ЉJ'8ED"0e,TAC[|=Iݴ#\Υ}lx Sx6tՉdX 2SO̙0^rwvDFɠg2[ juMUNϨN"HK'D,YQ b;VeT!_U_"׵AHU~(4≯B aF^H_c*·d{hKB$:7Gp4(,} MX:X&ʋﶢL_HH+ru̚į(`_64i,)N>:hC3~ږKúUtNΣ{p9(;ҍ}p4_( ƅ&^zwFegeߕ*#uꑼlW; W8]g]D5aĀHI.%4jYa.:H~Bt\!!q⪠ʔIᧈs;;=qkH@Jm]AbVD\//GnbR\hJv B?RYnw8'!xN_y'71Hr01+zH~gq/-Q_ufos#|'})?Uި`8'?˦l@F;>%?k;W)i " B`N 4ٙM,gu,ndxc7+ם)&| idJ<@c( `@D[y _ 9߾e[m:Yԍ!+})o+j Q*8b \) ~C| ! P]kC1@2V.#|$ > SPJaI9g50]d}[̟`X{}Ei밬ɍ'НJ PC=5Rm*՜0{i1B˳A,2,Qw||Qr7˷M34.}j-Tpcy_}IePѻJ;S ^$%*2h {,gt+2~2]/.ts>m%nT),w$&Hzm8 4ԵAN_3릱7$;3 _WxysKխK 5NZ4Ҡΐ I1s/6u9vS̠ 5Rp/Di~Ĺ6#?ۂGz2yU㦾9ũo!\yhpYc,R;#LKL({7xU _r} WKmQQl#QC+YµQSm0t gS ߴw=5\rWeK=D:&QCt岵5Goܱ"ƊzxD\ *t(붇E]Pq/1"-xQ=H-AO?_U nnx`1[L[;gw2$@Ei$D  rfY} +?o&a+z>ќsde,LU0S-V/6|~`LE貿noS3%D"LRjR |u &H9lE Xp4:2o%Jw~S^dp9F(=,?. 0N#9hXw 顃v9;xtӲե=noC'wćKTWS1NJ}Q6=ʓM3i_< pA']JS)?Z(EoJlWw:] Lo)ϠMS>!AؐIAL9ߔ ;iAxH,)zOGZ0/6M[HV 0E5 bVݶ0qD=Ụ X3&D  6j/v?A|p1@c7UiRgQT`7N=`u}=933 fK?B qΊ OTώ5I':'U!PW05-c r+u8mwU|) >ݴ,`3?όZ]"(3E;JO<ĪgO e׻?/π\vdgthwz7El7Ɛ2=_Q] $t9 N ~ŭ_wzDڰi.-;+P uWXMGYB=юFAg WGyJATxKQ/e9xl2 ď5bd=Òf+ujzԸ/2Kajnu ?VR/- פ$] f<̍ҰBL[ؚfy`LIq=Շ2b`V9HɠTtwB^&LCq%UQ(W- '֍]]ל?vog=Ld,qyw/DL a'8X|B?O`e8fn.!!Jغiu8vt'SQ>O+.tǟJ@~sqY|Srh{]6W 4Sx`V,$ ^3[-$"=&, 39(k}XtӞ -0k >U-ȅ@&M ќ?M+k3 $*˘8b''}Xl 0N9@w|<8zg/{t7$;R0r`v0'0|]& m-$o{{i^˰X յ˖Hdv[tdD@{]0`D,cQ ? WbIX1Hhb2=-X*>ȇH0CnJ^z(ˬpnU puUyW{zߵ|f~dRw|G [rQP#E] :rI D @# La0AwArH%~Ӎ`UD:>O/#α(g_oCO !׸0?Pz=Od Ž1=2.;-EtO^^A7NbIE 'BtsyX;NC(/#D#9jySo?WBl%/ۿrt9sqga$#7pV7qord[?*?E&uy~YZ3}ux2j n%I$yAMݐAjgKđI"HDҗww=XEEC*Tjn-&r˲ %-[oL~Un,}/7V9ibۇy'CvfSDJO: KLП[`,4s-C &L@~ A-WV}XU/@/V`%srS7 Zͤ-*+)j/u. }5 YZWb$ P1>}4Hv%[̓:,4)CЪĠv3 ΏJLcY`N x*,,B{£0Of#s&Z0KFg@$\!&`ӞO S1w>X.;euno7=6ehԸuQhg/B Jn F$F@ 0sJe1"ؽRϰ]eT |SҝŊ)eGM鈈@'n_$}=wnHA,l<=~,N[cf`*}p%}lۚ>>4'TB=ӂQC 3>N-u'GÁ`H<03/7Wp[M/%=_]hƅwPlW}K^,4Ԑ3e?]6Xjᐭj=|O5Tp@DV!Li!T `wQ! eK_[ՇHiEgPn\T7Dgk=]v``OC7ЉјG' ط)lKætfVy)}s5ޚ%75c<U.2ϋ'j>ⓨ$sbv0L.5^ odƖYkWfIbޛ(Kʨq, p2Z}Mj<I걟pZ$̐DK gX"L!R–[W۔/N=?%=3eI–R0(^t_"c61 )8=/S|LGLRP;|%+;;i,^igwޤo$"׳=H:&F#Ӱ\˽JW2"yҒ!0FX$F0`*NUS7H~D.~*;ZJگܠBiy~5@GT+]g5zM>/t4SIGgc\)0j޹I_P}2TOǝ=P9yDL{ɌQב,քQע}GlvzU H[ N9vu# e!^{_s0m*%uR ]?t$7o@J6,TP&||[QW?ޭ~ "ffGpf!-<4ci_b4úÓ8[+S[P^#.mIaʏ- \4Ppw%Wk~;釨Ճ7Pg<zTT$heZg|cF:kfSMXʩ* *piO/RV gB2:eg^N2c;u+/B "M^⚊CuU:mZ`r9WE›K~^$?bݫa0 O)Sb_1[%/pIƽ̘ap`סs3ڣ4JD2GGeWhv.{dg[ >-cP˝mZ&6a4?D!iI,t6?ȯ=hŚFuD,#F8hC}kd7yfm+IkFBM x50@ 9Љ~*I!@o.% #3W}_:;Uz/mKˆDoj|n/oZE a | N s6k3U5JmnS0ƛ@bc+Fë\3pz< IG89ToK|CFQ{"ҭvi`'2k!C).W;!>Ģ9θ.˻ه] !|Kv>o 3]ЫfecE\OX |n[|b>}߅gͲ(]l Bkw.p(cۙ6?KPK9- TZaTRuc7 \>8/b}3yb .U7k W2-fM#FGHP^;RSgrmg|){ SgT9(]c#F[ʰxYapC0m~!S10#0%DA6%q>$&\\r9B_ly(||&$z9.LS$@zc>@ZBo>bД?xQ[z:%_xLJrKHreOT9@l!-s` nb Kl'&殲7H@)r H/L+r t*ΡL. }ϳP9ies8^B)N_f59ޯrƁ~^`$ r/Zf}N M!v!ue$ikq P*oh0&1⛁]Ə6$*C(|:/ MOm.R6 @աf5:PЈ_hYB JqrUqHV T=3.sxsܘ}}^;{~Ƙ@67!e5LjP֛GZ,&e?$ l}`+3CPot\4YD(KPɟ` ]azµ-k y9"[GEE)AKww{ȟaӠD*.D ?X~2GPEXV^V(ȋ ,s7!k;Xӧfu*EIIO]jQޛy| ˷cݜ,ڋTcrfձ#-g-o~'ˁv.~@ { Z9~u$  &'dz;OkM}qGZN}zeVT[qN_p r-QLsl]{Feb}B+HT=7h: kf;NĊ5(N <+aHq:"J䚂2A'ڙڅ()Ա\AXi岭~cBb9LRMsqq zkǓ4_/_{FxÎ؟_0bBjQ^zʣ؄űHl-Bvޢ:WUN'1滋58EeM zűoD >`o.U nVA|A}%W䯽Vl5[l<*K0Ӻnj.I IY9*[.g4 _<ޛk/ma:ƅuix-qvSHxW}gY{#ib5,rҲH8`}wfJ>=EΛaYUVaBԡ$LѤ: F|F>TOUtJY_e:3f*i,m&HH]3m(BZicdEJ73S3RF>!CޥZVKtNL'%^?j<ξ?)>jsIߵG9ߔr*N7Vv÷H)Jٔ7vJs7bCʽds&߫i|wѣT/!KU RR~sغ$d;lk 1~> k\&7X(Bdi!/;g>\-$~4^Bo)Yyy`Y.ߌEKܶwZϏ'齐#t^tCS:t!b"X"Y~Iw%XܶOq͓b'^.k)W:-S?aZj"QQPP5Zֻ64w .cE!Dr*bɨ^U6kh̺DjL D C~Џu0ޓ!p.56ss,ζ DLޱ5_V *D!@x ,,-hr [nw;:7.K *D m`>'PIӕj> 3->3Q9<HH2Ao)̫v,ֻ۱B맹ڪI!S-lQ$Wr4Z- "AK([댢6\؄mlk~Z6vI΄,paeX,ꝏ{}O~VݜhF+g쬍TVaE>/*[;Ɓ,Vt h]lTx rwѝD*pWo'x' Ko/uo=OMexPXP@ :K9nn rbD h3Wt!}>iZiaN}EґSBa}0@~<L&,Wz|< 0|,Hߞ^uKVW~nЧшl@?Xy8Z40G[0tP=|( ,_?z͌ u*DAD_w-+ޏU Lu0ЯvrG]xƎ4Mw9:VdnjA vy%՗*fOzI/!SVrqYjsptᱧ@Lـ!E tt nQ_!ʃO~?3gP??r\1 1Hghek;f!i9I1m@&kHx7V?Z[.1RҬ mע1ps8ea I>!t(*® AL怴&@.N yrMP;rgZ-Kf_JiM4N *r(ř2Ǥ>?E1# 9{E8+Zuݣ|_q_sS;2o) Klj5pNq\D\ "# #t͔ yg]-ٞ Irc0黢@z/zEE>BѾ&*)|6_{Zy3^Gj(PދR]JfǺl(HRwc|Uy݊=9}Bԭ4}S.q1ç1DugRLQˡΟ+4w[u?]1]bQBK9H1MCf i{>2PHu~v5?b@~gb~PdZ}E?VbA )#CĦSIR λ m{}:?!rH G =h\Z0"`HtTj,MRD 0"E^K8t~rպ I5I)GP KefGgvXmzD@9̉q#+ ~O0 y($=0рP~exZK edze1t:N8 NP`]bxLQ0ʄ]C4*SHzT ty{#L~rv཯Cvں>_bUOHPDB 9:!(,#zG!3XEZ#,\9G )Kz5~HȀ֠PX[2َݼS6h3Wm"4O h$ooy|s"r $m%3pXf{ֳ]1i/WIt1Ug6x7xe&1 3*J]xM\ނ |inx(IeeFILb@"=jP[;|7k7/>6}K>wo hߏcAgS"p82)~AT4gLԾ4<:E DNDJ742j.w}sEE/daӫ A$,{D[4Kfф>%Q'{o!p2eDQUMDtsV˽_ϴo$wb5xnb#ssd=W$Yx >irw3һc+%R$1y5C$GQl}Id- x̾zhD0NʡX#iEEo{x_7((g3A,!RGl9&b$HFGC҂ӛVtN}BϫF^V9jm)1?[(p߹RR _79$I˿⽎W8vz.@$HN%c,٤AyZ9\>yWH?6ڽ B`q[DD`lǑ3TE)O׆t(nitoJԞa$:&y;l?/)>b-3RUD DȦO!o&9֝ef˿GggWKD>] ^eљB|Z%`z}ej&(~,&'`5:yߏz>m{= -#Oz5W+YXz}}?ܳ~ǟe]FATZq wU*n IZnp^t_qs8PT$sk{~7q; aH{ϋ#q:~<| y+W}>$9PN~Cs?fB> YsR z_/*8r<yQ =gwJ<4Џ.B1igԊ-.)|epE0uN+JVSP0;~{-enR?x?ңA\S؂~ 1wtN+he y >=F'=*('('x'~XۮELƬ[oL,WA+ӧr)Oa߿ʽ΋3Bsw`7Ճ>mWA)A:ADKȃ!lxW:e#.2Dgo;!GֱJQహّ$ O>* {|7G1ۺ}mؓ* o.MK[5m γxpa&udYVgh/!~ٷޥA?#EԇmuA'ԛa #._6/`<96z5BW/5]̲y4MY}vO?}}ڹ{ߣ嶟#.|?L\ģx &Wi[Y ?(S{xv|a~P}ov O X5QAiLuCx3x=&J!D*'OߢcYfe`T^ ڙ)9E|g2:wY \zSV]p.W"ӧe.ܟ[oya|Ep_?k 𒃤jI I=/rݟ:;w82{U;{ Wufy3P 0h p!5~?mͰ%VE^2/̼X1oON"o4n?XjsT/AGz(d=g ~pc-=P@YBO*DހP;z*Ik~[dYZJIWzT울:6ȁFN ͯ[)e%1(FTl^Y.uzPgOrڝ7fit\]v-h́jCuԙ/Ivn"h7w0̜tbQ#3qIf\EGEs C\Ww߲Cmq17}Ѹz{kgkP2Xy0qia7OǤ…]?< ;q5Rm&$k+eA2L!;-\6/5ܦiŜ°q8ò@GCuTѺg-4-iQWv#─Jx .;Oµ*I$0CKZ2N)lUUEv*'HN汨YԹ)}jU̶s> ݁M`OTy? _msQvp`zP[R62,F8ç|ŲB6g+n3Ha-}HXLAs|0c([ ߿w$U,\/Z{beb tL! E! cM-c5om8&/^oCjƍ 3CcaL{^S{#4>;CM@TMwk mӄӘG V~|/^ǥ{Qv=Dp9GLx'{xrR _kXtCS$OX.&8 uQk5* O6rv{يa.t| sۤ<}џ\g۟]v@]N;b0TSԍS%]_Ŗ=^nuWXwO>trQ vﳨE8݀L ჿa_c95/ ֢LLd1Y%Fi7^J>վOHK b.("׎\uFއ܄9Lѐ$,(r> _XLe^+Z\SF_q ?ix9}r Yukwc{9=5M5%W[y||O t|<_?O.=$}dPue8;M9fV(Z5jk{?3dH׽Qf)UusHJLO95ӳ7{ q[^ZЗ yGyP (3aj~Rcq2M^ѿRgGO:QW鳧06n&`dkOCa>)ڜw|.B齏[gf_øgA>URp& ^pvt=_˸9cѩ;i~ ζ/Ue V9T9!Rw1C* y$TXQiߤ_֜/ȷ'lюbX O~w[=[k![\tƫ_-vhT9*uÛR)K{/ KM,.ެt o(f z=nǸk ݾeB5F!&os3j}=6Z= tw|o5U7 S@8a"Oc;yEsIŪs2.Tur9L=`q"X2x9sҁզo2#;8 jn7҆B]*/uڀyKksTA"DK+G3I~5ws)Gf_T\ REMTADR8j'tKQK9]&016Je#IOi ؎uRӯIHMHBOeÑ@fmR(%CHGS.iP`q!&\P*)_N 1 )!kait^ >(.;vd /_3P%s.*˧ 2?tbe鏻QReUP3FBICK4( wzHK u)^j"{%%RZU#ŕT/T]%*#uߕ7~e%^:8( _`t C^a ilSMwx{JQ).b.^; Ip=|]\yf][XU;|nuKVKѲlD =jDkà 70we}yAҜ[lFbȽNl -\oslʑP0]rFk_$A#fNO%ha_^:5 O2G@Xn㳴>.4ٳ[%HS8{VϭaİGL(fC\3VhoCz]ϺKţW ķrTs,[1iu?99Rcmo.PW<ˌcUE_*Z)L!RTPxy#>!m::8KGTp)>`g?jr~vU^Er/937-K5='Sa}]7MKdI}%oKN  epOG 8B|YaP{0<*حܽQgLGju;kgL:]=}r]ȽQ4Ĺ3yL'F@E{4C_SERvå]V4 F1Yc&J1 HyBv1 $k%jNgܟ `3;mr*< &zP ؅ 3qZKH-ڮAU$Q=(;D3i.0ٯH:'EJ;&9gG5Jr~~P/)0S%4XJ^l5}IVqϦ@3R@*KىBğg A-yd✐zI_DPl;_5ίd,܉,idM-F禦 )F?JzĔaYj|^W|Wነܵ<}W ޔ!k/9%ҿ~N>+al}璌g&"e^Xco*{&q 7"&ͫI$7׿"Bvӳn7}զj/}^QSo0*ٲ a;(<(MHjh?F;|䃋ӱ@?(UJ OPFiϪozepk7бQxTCG"c%"Q"0Z <!$7E|dX[2ò:뚯ںۯ $wMQ֥xj^M~H;s!G]tw }~}sby@)#bԗV?tٻx_w!OSЀϋˣ3jms1 M1ˈSy>Hu w%Y晰w)£))ě7ePB!`]lN01 e97lBy!r7yBb=Q-,2f먔;C64'T9.ROCHϏf|6\Cd@\VzoH%(M3(Spx=L_:ٯN<_q 7;MⱎQ RD”x= m g"L7RhphMi^i~maDMŖ m3!9 .r37x_w3ZAFD]ٸTdB%I4av\|h,|7U (t2W/t-g qtAa 8{y('nvȡe&>L l>u2=g"˄12;a .!0Rg@%u6b)/-OB]~ޡt+#9 ex7k+/V5=I[w8YW:nt_%RzvidNingם6өڦRo5E !x'O18ſ]jܗg~Ś7"i0Ai5B| .vQF=&JgqSJE `=cϹ+<.w 8mǨޝ fB| KuI~)~˰φ׊=rې!sq!KYylE)D39KD6D>Hx" o>!}eܼr|?p`KsT|-=b ~ƫ, 2jzhtCtWS.e?ƣw~5eB8nך`t PT'!5́B@aM<ӆT .,5?>W4[l: ?! #abYq™_jq$q'"4~Hs1|p;oZo|:OY xWV1k6$h=?ׇ$-IH[raJnyI?{g Fh!/ȧQ0nݓH\st0@;aq bS(Sw^F-Uc%`ax6YW,r@ 跊-8hۦwp^Xpʼng 5O=}U{rNV 5;Ŝ3 )z^z^z)xRqR{?4c9!30iw|7{!zFhB.wAeM_&Q 4~6/x @D~TJ>M?摕 -4Io_)L:4t$cY$0[ <(`;a5 ~I %U!i{R?ȅD'q'e&tjE 2Mi] A7)jiV({!}mq@CRH6,/||'!ju?ٵXGuD2u{b!v)=?-La7eC6SFolicƢ-'d;X%G]67!^ #T~=C.h}ה)hgZC,naצnetp+F\K֣.4fWkhS:'Zc1p|^,|LlkޕXDI^5,Q#FJD_b}˴'ȀKlW< 1`Ӄ7_T'`l S^syR7sviH$P⢁T B<𪁃Rc]  .B \*0<;\EW/o?g3VpqlD)&6KR>A0CAz̧9ne"cS HܿsWOwzR m+ks0vfpg;r^)+KA=ЯQ]ϣ"J7ypы:Xak\\- Bu w p=m/lO.c#iT\j `pkd@G/lI~*CK|.5, Y};e݊8HVTP `qLQD`X):ܟ3~ Iu΂tj8-,uʅgw"/D~7#|ikbg}X[_g˛kuzY<6mt`cON~퐪|Oi57AyGL$2+u:VԆiY%IZ&G/)D=_IJNMtPXGZG5D/d37ҎCG-Fw}x3vd.O® /KJ)@(DSdLjA]Sn:.N~0}f*L;,S={_gja#]-+aY1D7j5F?uC| $l4BgE; 3XGuLL: |4 O ǹ?_Qr 8Mrۭa_NcI>%#.vBrq:+Ļm'`iUBw\ut:zjaN!Ҟhתc\, BWUe[L[#tg:V'Mf<o횗,anܔ0־^lsv((L2*C" Hq\MWަ/L~^&.\܇#8 {dBϿcMՕ [Ïf5S>'[S/$_7?Q?S8﷯zC6Qwz2.O{1ăFgVΡ7iKqgNEUUK2RJ|O*g t'# :hl65)1`m-(pke[ߓŃ8/,:|o87"Da^BaE2]> $[/w&T1^ݖCp4ЫK7f %M ?LcI+, O3 DŽ 9;yF8D,2]qʒF=$0jC Oeׅe?H$kŁ $~d`h|$WIx2Uь%٢+fzX=D!1Şeþ]^GuU5k/!İ#,)\?|o2>6-P?"Cʳ`7Bp{QDZa 8]^d'wx sv7x%W9s T{tfнQT^9G&_.|mT0IT$v؃Znzsĵ7'64 ^V :9IYC@T} |J ]M"'4I<nViU;_d\4pn[CDB!{nفՃQie<YUВkN%,2#8K 暴/Fyid&(]VףSQ _>;"щ gV]i?1X]M:vYg_AHT>`( jK{f)R?A^8*n-0<~2wCcNvHd4Cpzn _ͅpۤ cUp6P ˫6W~~/&\υЇA:uxnP_},~< XH ,.[ \{;^Y=^pSIBį>[?#>Ks# k^&E|v#>/_f|-L$@r<4`<\b5iQ0^]NŦy@W׍lrt?ۦ (CGײRvU܇STk%2g>^ Op(xaTFEUM,0)K$x~T:끚6BSU9meLH/B^}iIm~b`eYWEƭ܏ l;́zr\.!GC0fkr|2ߍ<ko>a~F( 'n)*of8+W(&}[Xv`9k]tr@q mH&)ފXKD$5s?c1›<%FeۧYX3a#SDFIa;HiM:tM}: h [%FN)$C2A2c 0_,ފ(4ăqFfO؜jDO+9ѮHU;8Tꢥi|AW12SG,u!SP"hbuA m}4c( ԲGF>#_]#0Z5b z.[<>$cPͽ_~L$[d᫜Gaa$e$ᤆFiIIEuX+126Zb^>`$1|~2LtZ^WGҭIwp+3U5MNh5k~'\F@з^@0S>U'ߵe y7fCV;N:Ec g{ 3`֨N0gۡC6=LQD,բ۾8X|JANgH`*vހr c}<^Ԃ.-V,ڴ+ƛ\{͵sf\4t.~0[BͳH[HoP!qVOojx&7t{=PX,qF\~sWh6zq~9ӤƬ=TG iXXvpO L_7p&^IN"YlEoFWӠ @Ǖ*<{YU G^Pr_^mN hFבmQ5}.Eo?`w7&e0$kFg=2񄠃+6U;wsTv{SuAkBq #:>L0NK*+Wlt-}5 #y5SE5!b/*P;FRH=wHdEb@DځYB)T pLY&WXzT͞OQ}RS95V."(5ЪF }h-_n&0ŭc0ׂvSXݺI輫rĊbn%)͐9Aj+c\ 9XFOzw@S\:jGA?r 6Ƅ@sOٮ3 9 ]# EHKqPB5}ih=4J 4!NueitC ż5KL9sհQ><1/L6Plo:2ݘhnOXn%ldN LiY 8IbFȧs1CGV^s4]8*R}>KP-cS!Y`M+̯;H ,U*FG YҮG lĊ7сT2VNI5}L5](H]tPψSnmpFKJcZv{ :(]t,,4(KIq/CrXbtwS(R>Q| i@b!B*/{z[~|ZWB|kEF5M|McHL!d;J6^}: nx3@W `R futLOEb[USTwA Ы 6 !jwINg[=U|4%OUuܠ: XPy>*<]ŹuIv a5|w5#д$vj!`3UNlŽ)NI^&N5Z{:MUl}1[ŭx`uh_SIgSz8}?MDO;,1eZ@67Ĕ* :p6j<##&Dns  /j`61}@΄q^Z5d*r2_٩CQB[Xo~7%@qh}%? 윾Ui~МPIHDmMHGT?}caG߸^X4kWRh7M8Cɯã a6oal?v#P fPr,`vVJΚ&9 jk]"Pat x^S&E x7W"#E;Q+W!SBB kFvh:*n/N7Ōgv EʳJb;iAnI#n^avWZJܣ|l&Eޜψ2>mH;Ko~(9[œ(]f,{{U.8UOۖ;LJsspA0~(Q! B ]b1Kf`$ۨEdM_XmHb$$QP*6~/sF1cN1ՆZW OG61=ɧCu~4MkW~X#/&0J/ QXaH9E$,e9vKMw!>{5. >زOP%^.y;=j)?@;NJ\՛{5OC\9 hvhʘ:39 A |x)=}߫tMD 2:]iGP= NVv!|\xY{0q b>la19<.@?(PC0cS!0vJ(^02e=*L-\|g9P2^ .l'm/ Ԭq1.xhD?GK\;kq@Y/!)󋐾yƚo-a ak*<>s{Dhh κP M/tm𔭧Km].'4*.ߙ*5@;B v+i٦aZЈӕ/E]2u%tr/TYʈ:PhSrDRO\h&fx%Grg:TWc-UZ5( :>ϧZ+G_2([Qet=ŶK6A.sN*Ek5 #]"FXF"9CbZ `yn4τ>HՁX&&`Ps ZR$_3gH{@DI:q`9;(9!#ӔIVR!LhD[u' k |1U',hj"b.vliiDҥ Y%":۝/Ì95 ș׫פ?v7R9ZX$O%Riisb;C>3B3q)%c2T>_0۞2'G')+?q3$kU}&!o,-q䟐h  ƥ9lL=Œ޲2~!&:CB*a!c7g޿WN> u# ̋FS.gۢ G_hOT_x_t#2e!ְ,Q5HŸ#dt3~$dpk_M]JԐ|wޙ~iګHWfM:Tn´Ӱ&TٗSo;4D܄#iv_*"WB{!ce mnAL $Cj'r%u.o-'Օ?F\DZu,)KmBQ'FkCf\0PAcҶ|߀:9|{-k߸Q`?}2-I;zuqU 0td]j('B۵3A%gb;A|耺<qmWWd?bmJʠR(!NO ბAqe} UQV{΢=< )ㄬ\lN%cY?cJN>oVۄXkI_1$Z=,^wT i L p*҅A X BHd1ߒ:\}r;ۓVEF]ѭ^Sl&f;⺔>*}/@e+"+ dž0ߎ3;h”..{iKE$?X=ka{8E8[.0v24EDa{TS]?aZuݰp(j~B^*=gȳZґQҍϠ~)^={29m%uR\-$&nWB3#]vVۘb竖`!pEcM\tbK|9ʘώj "; (PE+3';\Z\nd(EdDk>}iգ`Da"ݍ~NcxXe( "bé@ŮQ 9W?l$`:˄UoXQ7JbXB?,k̞"|@0HCL!gX;kYH2lt5ݯʔSt d1quX;D l->`l"ߖh?OŻ }C7v2qhN^ިgY|QK8z8e'qE~T>{M+tbf%$Z9Fqj\DbfE%mfV**~hkdh+ [eu?{q'ie)JnzDCۍvbWN7)}>Xytes f[a|{g%pyɾe7{vމcE)`gbXrAzE3\w?.܋Zt^2ʮi_酀fwtl^fJhH[͇ 1 O%FW;z`IyF 2f 4Tg.mw1} ܑEү"k> eUOT҄$Bgs(L|~h&Q7ֹ XIrJT=e7TJ4-"OCjߋ+⅟cI(%DvM{H'd]9)%ZJR`onv&C)#}I_2.BKpkvi3 =)=mJ~Q=.OŒ9q]PBXr@ΑXg%)_k=MdHq)p,ۣk.pUR(mSRK5\_~5x&/J#v=䙴2яB%;ݠMkv-)g)FE(/oy1`^ޙ7 xme5? cE.4whXA3ٸY,2/4FOX':/ ʈ`?T+*YUV4ӃRͱ?٫p K)X {(rڠT!.LDRlh0n@C0h2)ooczFQ`-%:v]tNv^>1RmK5rP&sD Rj!ErjDaԠ4lr pvI-IӰ=gTf1[3/}Jm~7Xkж{T4*,ce5@ݗK@آ8r?gL6rviLkzA\BGt3 VDzQ =O>j1/帖*]ʹ jffΧAcZŒǃΒDZ!ɚy R]4kli%1s`(&X9{w<$c;l֐渃P0Y>G GZW/ZkɊUzV;%6V`8X΅ w'`7%Sa"5ɛ7FR~M2M :4eOem+͸?u=Ce;B$tR? <"?Aħ^d苲ʃPfyb[fޮa,AsD Xhv=ŹFV}{%UgWoS5ç-SCji"JwvDlO%+P&ۮD)>:n9]? >׆B:ݥ?6En/@>)Z4nmhb͕ѳ19)î9-4Bŀ'R+x rJWEXu C ziFoZIuy4!-? C$r;'Y3@/R&oSqP١![_EU͔P!IEaw C[vqޢ,d%K};ZJ\ ]*|@nB:'QY>aBk1Rha`3 0VZiF%4](ZC~OkY,2Pjc{r?ؗDM1[e>=q#,mف}X!Mv qQ:rz;4fkn֤CM_]Lt/F5뉱XQLGzJWe"n˼VRENm %ٜL!"C66| tB٫:Co;w0Q0] [bW[DxYQQz9ѯ rbLQ?bsòLePK `K( LU.E {vx]k" e\O2uNZHϽeW "I+,СҿJuN}u~ sdg>*m[ga{#-7 neT'NW=KAm3&ӛ6U:^<[^Ǫ1+MWɅZ8LFy5#Lc;E1h24}Ϙ@PL՜BD;#/+XQŸ\Zԣ/R73AYrruU@f24rr5E9H*z؝rXLt~t` {.Zu=OftN1WC,т#u4&M>\[ "?8 štW%X@^5%NyEI;L{#Xo gJ)4Pd wƢ GhjO/1CS>Uݭn&{&-v7RXDw!UJcxeSr=.d)VV0#fn/:\ Bih뇢bv<#WpvCCkDQt:Nf:[*w0]6,[իj.ɀޛ\&nmEBU1^i. iyX ;teb?Mny[/5=1~ײƲA^ ) Fe ?~mN)iVTq4*󆞊Xl6hX:DR!cݲ  &F=!@Yu?,:lc6fq†[4]-(Nvr5toήn[o>ԭ۠UdiZ lanH`S`Rђx/֗#ו.sШ3Ij% P"6:A'/ƓnTꚄ |Y-{Q@iWdu4ۄrʞ:$; >F;4h`u3QKX H0a42֊%\glW@5s?u|Jdjg=kvZP 5x#iĒ1IswK(oDv"R=Q3ɩCf;l9n[Ijb:rjsD V[%wx\kLw dOƗM@w(x/qμC+HG(`U[tv01i}O??_'S)OP0mS~)"'>.ʸB@Z/Mדc4F͇ߟVAmx-6(KEĄJJ7:@.01_Li@hNM[s݀FąQqk^lt=v~#)P; 'Xjl*F.W7J!,:9? 7d=K+»uqc0;ln|?lTR{̍,sfeRGwj[GFQ 1ovH.T*|ۗ~!-õ?9,Fcฎ});nkJ0%С fsk?.L̒.[yPV*yۅ2Ess큡M]P4gޓ#|SSg>V'y ַ +Sdx\Zm߅G.6T, }vXEeTfPn)Fs`6bTk$|U@e`lZl9#_ޞyϸ/YUBdeqۈ%?c(Ĵn?5ZIZ7dž*D`_8'ex[qg'_ha ?j~6HwTj"@jX_`bRlJ6b@۸=GƑA/%?+x2r@!hD>4AՊL kE)yƓg8XeAzO/-P38?F~j ճ՛,@X5J:wi"JJ.6TZIEz כ20 t8)a }EꝒ|F({b+K2t!YP-1\ bLVq2`My54n*74"L HDBl{h '1P3,nyv)}|D)tzopnbڸ8,r|p<(`XIg#gTnt*-nU2HǠ.| DS^Hs'd@;22#V:iX +&X{D `AUhˣ0Q0j3) }Odx*q+L2Ci,X#Й_ iɋV^bW9ݩ"b-P[\"k1kbñh~yWbɔwnZ`H;୒DrOjٷz% x67\@$;7V"ekY2d\fƾd)4\ϏtZtfџezEPR?:{~3Th q N݊ gGՅe94h6|."%'=9w:8s7yF1^i#o DĊ W*)xMO[crӰ"^I ; )ƒeOP1e7"TtX#$ڞ J %F.52h_y75ry8W;^JM_WveNyaa!`ع-Y*]J>}5MI3r|u䕱lK#5y"WR9t1r!ЍSp &g~XV]$Xe"{ .%? j@M/Z}=ׁF_΍aJV÷/b]{ ^/9T}u2A!&9 R:EF÷Tå/qӚCG'Ŗse%ZofٛFǬ:ilZD 4NJJ6"m8T4Ц9zo.#C5ڭ^ W4ѩ@]J'Gt5T}Uߚ+8\ $I_#W3DJY)Znrq`"eM*r|oԙ^Fnj[c>$j?3eRQwxa…ng9AW My]B!c,Tikl#jV prN(K]ZzFoΚ< #KzͫBz4H4L_5jd 4rIsV1 4Y~ZVd\֛2uZ v b=؍_G*]dQzf>lus]JCq&i4YfaO4oELy' f]:MD L#J:\*ʹCd0Ֆ;:*E}u ͘`NEuVO֊$ a%h|"gv,R1T!8~wW.H + w*yO]*ÐΒf[aq8/T!;]ȂJszRRv̖? ~\$$/!~Vj/$L/AV` Ǹ5BlX=o5_}j:_}HX/H,&[}#u xu}ӛ?N&fmQ&&?$4:}`0S"la*k? 2*E.OC Ť hJ=P( 1Ed* k J5*!TJvf3 [czhua˶n6߆`MY1fIlf.ieW΃Ls^FB<ftAjJ+VWxwwiInē#:-pu,8T{ Emѧr5[pAkU45=?1wqp9˶l*f8TdTퟂ4!Y3=cxP R`gO{$Ε)# XzaP]}DWowaIxbW- ڜA+1@ \Qb)‡(_-oZ5DB7Fo1T>~]ElpV(ɷ6^MyC_cJArkxF- RN٪:FxJk&sC+AsZ0^AP^i*0Fdc/ V1*=FJVZAT3r~ 48 | 7yCQ;TAON=D|%#_KZ㾸QŻǟ!wDg^=@fr{eaFŋO eX9g}u8n2<[!_Jwe>Gbʼ}'K9vDz6J'C8@U6'%_4 rhͺlnVwI=odK<SlgNjvIYvT<:rFU?Tm(?ބa֌C@\J6,",PӔRW aFPa+f.}U37bB)"bUtN-9§}mD %?DakJe46Ӻ@Lx#wP5^O%gvwIPеCj }XUuIp*ں+Qզݯ]L.xSxs/wB~|{I6pt tx ++lЏ̾R1Ai_ʹ>-?&ͩ^N/u7CM] roaG Nb>LȤcl*E{#1aZx,/lM(A=y`3@wιvZE, )HƐޚAoUMZEgy8NU_!#&B~l('&wzn2NLzڲv}iKi4Aqn.XM>>34gLYt.٩ojeP5~md% ^n'ܨo'ܒdo)F|o`+yɶM>;op-H9j rǫ0=-(71 AO UdNmӑh8w bs|ԀwfUgL'\c.j`QڼL0b DKt7>`\^TSO%f~k0.RE[1Xiv k~DȇXfU{,o0estk;+w80jVcAAfr I,02o;$,\g 7B ݴ8yeCPrCZr4jaȒ۷Q:\^Z̊$dFL<Ô2Ch H pp D&՛`k)D(#1#\Lz?!)gH`Vh-ʔ!y-;[cىvEz-{qT|5{oVo*[(M}7CR ,ݔ{~ - ,\crjv\6)ޞ_|7 ~D\A|/LMJ ?4F"NbVk]GOLNjU`k?.g)|`E+M짥pm̰ȁKΕ.܅`Qw!8x[!!M+%^+ĎG_~O&64y% &;\{3R(ƒHmՊ4N>֤4tM60#ۿ7QTy|_/=gR8u{c^=CcX8oznu(1eRG:k\F}1Qv?OB`>06 gzTT Kb}#Ό3B8-̵6v=,n\8D]B+0W֣l##$ ʲ n\0 8BL)~!܄1 r'"ݚQi@:i>=Yf[ Xrx ӆJd>B)e iݸ ˢ9's,'A%.lfo-ɢoLJpϨ A, 3b7ނտ,d -cԙM,uvDiSWtsN, lWfh(le ԏI1ihR+Os<1&3N!ihR[bFg(2kV:xor.,ZzUN_Wb9RT^')3p]E0rU BԢ_|[y!`7vm5R;\m6BH_¸ߺZC0. ҹ+BcNgp^7"O;Rn#Lu}MC]mc*\DEϓ‡cOp>1G+oaYw./}W٤j0yľ!*:-L pVhQ{gEt@vNB9۰zM;'@V pNh^Lu(~FBR΍ǣ1ybpFU3n$.>'czqVɻ(09Y^Y\`݀^ ]/0SyS,:5& ű]q%W\lYI-2.!D1MAYD?(X֣|ф˅"߶/D4n^9!~{+"QGl E!O&7ZӀ՜`gNlt1Zrvo'?.zܑ|PG ovbeXmG'0ڐZh”yQE1p~)tp̗Z0 g o˴ u0n(qP@2cf-%/|vy{?=rkJt/^a "/_} ק~wS&N ӗa#?X 툆zoa^֦ ^z{拖G$CCT.cPvoU*+cD86YSN~/ed&S@crU~%_5G\ųWX&k 7<*~ud2G.Z0R_. NJ >U?\m˷_,$ 6Sp W5!_@RⲬqboeh1uq}GtNj)X-; C$_IB N*?$ qGO(5|be00үyUph}~5\Z 'arTQ#gAllZ>IkrpV%ȟ.F_3rCa8&mhcjlVSl7[>Y}:/Zs ȉ =+~%]8*>)_{#iёm8Y̔`[O =LCc1>oꫬ{ITٌUhZƝcp$)EE9D̚ɗ+.6<52 D-@) X0Xt8RDϘwZV%MĀ\r7<u6PS>{m xs6`[G+Ktc#e+.j"(+4?ϦJN*S7! GjMX\èV3:H Ez(=p!F VcfЏa򅵀5 {\ yMe(`«-5%" x&ֹC߾ݘ,uV98beU#0ejj,CdpBuRH|ЖUEޤ8nӔ L pHKm\vItűYB8% /13?{o`Dng& kdD6:Uh$2wXZU]'Z"*ƣ:c̲s$ blNZvG"P,OC>LI0.Bk{oxDiSh=]6x˅-GFeB11#*Yp gcp9)גo_\lPKy]˥@T#uHY2;@\*޻!HU8=I,KZ*b8A|=:"U;QAwlkRVT8nc {6b=$=;_=P$/!_|+%!(xIA#Հ#WtX~-9elLe/FzCx.|iF12 <]VcVǘe|i.f#r/M;K$ G[H㬾Tc*LXk𕘧1 |?ZJ]#W12=(KLm[_C~\ ~̂n^V4\<'aKa ~qr%FM[3<%sԥ }:%k3/+WE, .B:/S"QuX7sc})[§(AIⴼ.Uzu )T }39 h6ڂuZ3ǚob4of5*oOȓژ"cL˷v;1ÔFRx@q!tSlF}tQb+]ޗ_`}UF¹.K9֍l FPjңܘ=a>AGzăB|%S_wJ7l0@]zjx=j%oHZmW|Ѡq񏢢>f7UP)y!Y/5[Cc V8Shf5I qd%O5nDJKA#f`[#mhAzwS6 `!,oDk1ώLTPEf㍤;{hP>ܧ>MZ@йg|۹!/@a|86}=+s{*w %N҂k)T@}?wI,_/G;eg d;e!tT|GS.P{r0e~tGix 2ȳ(ރ6Jz|1Ol/Mr,Wѥ HCgEysC 44VCgJ2^Ċ:8VMA=J츞V GR'T5ڑ@.DgzInXJqKœ~>"Mij)ԍAyyt)hHaș'B^xhƛ>+ DZƾpk]V]$'a}TR*;֑2r>-8o<}6їkC+"/>L>ޜ*q9K=sM|ixHlJy,lvo{kl-S>7Ɉ-c/vCu1 /aCR{5pXH5j64liEkj3ivgiue@#F|`WԻ4XD:&\Fe[GtA'>24'제E0؞`WUGN D-h+3:Tzr*3j(ÊSuMEtwbѲ:A\qänn{L8Дjxպ2x5X1X Y9CZAxGxCp/V^x?rcv*.G[LJ "ru[]=;milĴr~+NYQ0="ƶ =eǫchs9d3\͂q-7~s(#whSHEVҭ>1TV ,Z;c󀢍FVҜJm9[~4S:s@M_0XDFO$P'_/z G#) Tum^]ުBeSP]Si| YBir&)V$T!ñFGk/yMz9%,@o;# gap?3C>\kOɵ:|dJw!1  `Va*7R-{'[^ճFłGk`ئGTf|}{GJXUxLvĤHRmeW'%^H* Le0X0:)m!fTPi5 }J{% ;wdV.Fɟ3_Q2glQYYKCEB/ۓj'Ѱr Dc oٝ8U+08jHH- v$#g ie8HB?>M {FeA!)P'&jZ{ԊQD:e$@fb+.?a'4wp 4(yaH1ȱ-b [Oy#j۹/L$H *B OdlI^E\V/>(< ډFAȯh9'$\"uuZjA MWUafaㅅ8oT *w99~Oi:88rcʈfuR3:Z+^1=Jwj/U2: &~v0͸ZE,4Rǥ,)CwLhkoC0fB#l0͙_ooɯ9H0CcQd%f c ,S@Srd | …;m[(f(6jEp'vG)&USSMs@DG=P3- NN&F F5ab #+64tXM*@R4&Q|g.ޥúKl xU 齞D!,~D0>eީC+o͝u{`eѼdEKS])r*t`B #TY]2NtyK7YTg-Qe/i{|)ߣ 6-Ӯrdi هQru,G7H>iScߝ(hN_ewPz.'g+&s<8GlYJɩm{Y 5b_aJiu­DجYm ,^8b|動dt\>9ζڞb"+ٕ;+&#PCeÝ>CHhyrMPNt<6 V%O_eEA%sȊ~AvO0, #M NDVE;YKd(y6^fK _i/<\Wqp1z#Ӗd +KxQlUnҿ,Zވݎ)c?5nY-̦`m?[$poZ!H9T+ +Lo\ 5f:j<:v|!;?Uy;0ġE.f0Uu!8OEO1C1;b~&DFˉ{yZwy;H5Nmм's+͑td3}ဢU?8xem7USh]bJU{FBv̇UUUƫC鄕ZB1{+DFPw*glÐZJQAp`̆(hr yӰ{+ +)&SF3w=Z(ZG"+ş+56TS$͚Z1IH#yR֥5O|@ڱvs@+HB(I1Ywjb. iETNQI7>42C{ 1!iC5H*7~GNT)Գ%FapS4yAUp\(TBn{]uX{#kNSզ?g.2ٓ i֕{]zĉnjqÂqmșc1cV`ov۰T66-'(t\tJ/Ao!Wmƺ+ι⻫tW4/q3a:|TEd~mx 3@E*Ĺiu1ӓ٧G*9>1L]c&$vXoM#mVD IƷ[QqMU6ٍ "P ?&jok[7L͜Z2Xs}] Wo+*hlٟTV\ )<ԊGAM:uOp+n5aRaqYte_ ) U oxp>.%.?|W5DXU#PE״ #e1~R?<؋( MK$f[ !JvHO;\ԬBIJW,{,`P2' Ax5e 2}Ңur^ s+x 81H+VֳlR%;Ь;dɕBp-x[Vڋ\OF%YZ(N=fBܘ90f?Imخ92ߵP$5~os? Ȣ]km3G~kv|N]NcئNd'[u5] !llCGت5kìBVM5nCCۍCЁ,VM` 0㙖8\bRe;\"*ax;0Bۅ)t[q)\8ɞat:bJ|g+Z+ giLCtgB;ht(V7wum`OXƗ$Ҟ_LX9z˚I‰Jk{ $(݆d"nI. b<dz{ϑ2TisGh=-`+dȯzoO^L;9y̩|%? )^s(TTQ~0m݅;E2=x= h'7{Z8?qƤWzȈyھSڂ{&oNG^\5l=5W5'sf)ܤN}^>ڦ<Ln+xJU#̛[nۤ7ݑ:=!:q61PQ(ʉ)j-";X5\on%+1cuUW]t ZMS#e)_vg:(%=XWV ƙ"sYM{>b|.7X 31*aOr"d7 ~~J9/3L^Gzn4`wTt 4ZTѺ tp/ҩmŚ?<ϪS,zvZ߹g I0Ik|q7;c]/>πkSfIoHPb7DĜ2YV:]º'HM&hL˳>lesYg[@N%|1-7"5(NLmuiw,>`Y氁`l@r5 {d8e)*9" [Qe(J0m?Xaᅉ=5Je7PNCHZoyu8nҭ;b}lQo0n|\P4w6:j|s sinD2:j ,taj'v]/Ì3cj`zKsqŻ1s*A{}r{DYW&¸Bf?'Tj*}`ҺZ.P0Ɩ?[Xg\qЮޭB5\lԛUT崉sr4]YF+x%(cd|9uF[>=#<8&ʏ8X%&,}d-Y lO=u7RCYP p?:xu=h&cG8)zYEbsaST{0GCm !kjv1z#ck(r+8= 48_,P,1,M ,w*";%kxoqBYaסLT;,phQj5@?!m12_C`y#9v&(j 0:8v B@,3˃j!LAh,DjB :LꦬS-_F~X 8bNw+G5ۜUW9UzODd5}>@"7aci5x~|5/YUL{Ϩ]{CK>hḋ H#>TE"&cM'utn?X"3C}5%YzxZw,h\,,~Mn[ \lފU deuZ#M ÓgHXV+^}vC絯G qekAWVu6.sH6)//jEG}yѥVE3{/+eSD #Hryj\<A{t)=/n/JBwܾCX)Tg8'lajvo"W^3Y8X!hMVFI6mcbA +28WZuvD-\%zt  ?UcfDG&adCmL!|$C%aɪ;(Xf?a[*:40W%!4;8MB$bmT.vdݣ+u؀=p*GOH#gX` [m"8sf-&9 .j ޑ!-O9B}fͩF::YoX(l*zM$i5WT&4.JwG~JO̶V]MCrEIps d!m1s3\hO4S37]*uu"45Ϟ^Og%wF&uIW3׌x6:͡(_Ɯ:#CmV9#x>j&iOo+Pc dV*dۣힾ$Q3)DS\?>YBgK+i۷L$*%lɦssDCt\4AuANJs>1A%!R~RzYH^Ok0(];A#1\Hb k$(&;(q ԓ.̸_CoJ/][/!\Ъb5;-D#'Wigu̔=Ě@/qWޘ..?y6cI.fMޗcJwovm4w9d6v ڒ쟮@A pm#auP %P ejQ&d*뱞_[]`#岣QA+0^ bsfC >[߲ cIѩ i=R.:o,4W0ͳ;c[Ý]qi<2Лg(g֏nNs;V߯_鄂 Ku7\! (#g\ՆKcFfn<&{-Irb1.Ǒb޲;AX|m-?Q1hސ^C0q .'z)\AI&,VnW 3M1z jU5BWZ>J t45ұ B)+$'oB@;%B%0Y)ȏ}uX~Seܾ4Pn!=WX'[@r `f5F 7{R)H'kRHwQ訍xKIW^x|V(ˏKu 5& Lf'϶DPV|KQ*C&kDA'tt :8ZRq@0Te5e_Brw >i*_`BqtkT}yֿ5Si"*Kh83{svɿO)X~HWHH٤W*P6 zalQmYё$=EܲQ!Z,C%":=vƤQt^V~fSLZ$ ܆15\N,Ʋg$VkĩWD`Gu<:$u希H]6377:VVDb zɸ+-:X~l!@w?D96̃~w dwBZ'v V hrxq_bسߤ&|}dV=߸cz)5LTmfa >3vt$5 W>ZUIY`| qGS  U^A*KmnOM`q`+5P%|;,$!9,<SnmiNYEֽv+̄Emhe:Ӊd>a3d Q 9`5a=rh,:cI{QXu(ԴdC&R kD{vɯ]LLD_oBK֥sko 2ͳT76R".d fHpH\lR m+@\ޒi`i%),h}_OJI0n[@Enxҳ쪊ROmb '_%>!|:&Ѱ4L~\'7W<镯IO%W%qKxC~oz /% x}<^, 98 V^CJ3KeDc+ECZD-l^]l-BS䔤:rcXn}"ƣxsk+4*yeMt ]wiA}8צJ%ۆA}Zn;/pw%@vpPW0>oŽ:)ͅlEإc  _!MR`[# l4s?rz‘ EXWo\|.ȟps\}2wZ.^k=BI7԰=ͽ%VOlB}F)Ψ#Ʋ+ EeK۠rKw@Z*]~cvpԤGk1+<( >Yts")pC>WXՈ+#D7\R?v9"ܓXFfځ^.&oH:aZZEɡmT@zA@dK }Kp4W?6Md%5_+qF2Y1tmKg+/48z8rE6pu|qULMkm ^{DN2LԭDm>Fŕ{fZLk@нcxg- *JΓCFt '@Jmoqq~H?|Խl- U[g)-\C /O3I}(Jؽʸ`TKǡV=>EBannD)aO9O#M>'EߟcGr\k7HkhS^;>R; DZ6,[{cSb{ ]NlB\5wJD-UКbC=`Th N$R %d~OBK3:TAͺ-P;[8Oծ\R~!U|{'7O$a巇H{_@N/.j ^`d]AE,h.oX)7h43 Kofj_SmHͺ%R7(E`}#rḄga͛Y܃R®:!5 X(V 8|9ʂVK_«A*S wٛ%屭Geqӡ$nu8 arEdB$̈.RW\78'*l%Z"m_bH/"c>ѫ]Wd3,-AlNFFjO$]2S(\aϐ\\})22Y{c>/ u+-I8Z 6Y3ĬMpܐҾo#ոpu#ᜌlᲫN$y[aj!),8Y@`3V:!rӲ0DCF8d* (l ]-ݳINK)LAur7o`ԜĄřNtIFfAU} ]ANI%Jp6UӲ7!anͣ^ j+)1hC34n0?%L0] 1_ۡ =w_,cETM@#\)JkzE'oʕ@Y H&g|!wWyi97Bw#5BY`3اL$_a?ͼuwq*zHۓ|h~wéD$dzOMlɐH1 C*d/nHV+">x' 뮙5qn) j?Yd퍏1 vj eIJ0w/6DAuQxh1OgTḟ}_ *P)k$Pz#fX lgpXX֞plhd__-0>:]&hCb(:1=C"i yyesW5(wa)_e'Ũ0Gۛ?&B4)T!oVGj jN_uHE:~of*(&%hwfx[uCqeHK ,.닀̑ڰ*J4L rOvXU4eO#K: YCPU|$dIwȼ8wRj^Bۣ,CK8 +]˵[I!Bie$ҡ".IiAD[\ ѭa4݆g(4H1 W/,+ /Ӟ$wff7Q5/Qk(Run >W/pjV&Uu^LTV)Q,8z۰ӑ0ȶqreT[IFR cپ\=Ə A暆>;m Cd=1P DÆŝ8lFq+zyof{8֧llXvBxis3G%w`ٯ{j@&'<0}ULov肬d[^: 7x';DvIIKLI@IRi)븄?-b8pp0PNu{tϱZzh8mj7 Ox+f{O sd 53!*ɾAtL-vŵ4qvxnGLAC$5:<"\==L5s9fni:ٜ~Iנ˳y&m wϰOSLɃS \Ƚ  oЋ'D bj^}:/Lj$!6}b:CiYXD_z03(? 7n:GQ+AԪK˅`Ov2?Fm92E0)eވ/  8֕;F'ƾȔ>ODP^3޸xmjѓ6FڼT4v5& S6cD-(g(4=j咈J޿.jOBe^K({5i-w*WmOnln/WWt/g#Q|zчUɡrGXG ֹmN'l(Z |ß'`#&D=EIkU/ uvę{M a #n1 \X+!NQP֞w'X芞ܡ,͚F1Z>x{|!u]z{MQ#(S JAA7|D':u#T 1as-C:$szr^DרU?{vjM@)  .¯GI3ٲzZ_,)Gq `l?oc2 $ ihY}ܻ^UyD6:s@ m".m7.iĂđ[X3mFysVvIg:UO晴_yC[M2Noոadhw 5=Y*,tkq\<@ >PnAOB=Ȑ|1.~ /: 1b[RKw#Z p] +cN/-Ծ4a@C尉sT 0vS.r4*~*Ԋe{=ſt 2TGez:fឯ, ЁeBuzw (U˷vdo(&'2{Mʋ5.a9=!{b`>tX-xdH:׈iUzÐ}Q`^u&M;a(q9cj}a4U恽xDꑜ ǭý:QG7x(_TR06ӈ }i.`G1bO^,s@O\̗.)p KXϐЮ2b^ QxQWAz&B#E:uMέŐH<BCΦO zg%CBZ2EQ5vZ PlFh1'M5dY!W16/3Ibھ|||*ӅSSABIQ@1fn2]"x)?" &QN#E9bPJD >(r>d [@Xlob N6UsNNOkEõb} I3ծy4Beı)ϳMpKCA&"zYJnB>QC~Q'o$Xu>P~}IA;󉟌N,7 Ft̾(2#VD@N[FJJ@A'piM[5GrÃHq+˅&Tp! q5P]FlGp=蟊_9p+9ǓZjWCe{mlVoOO :ysO\c"UoI@Fbw* =*ofݠ  pS&G|u(;{YSXe% m7@rn(2ݵ6jRjmmsH8f<ʡGxWLShl>(i% R5?vCa ȵWBUBzkFM3dp."مG(m/"gvw5dWx M.1YwBZzhI_]wt43< ݛ?hϹ4lMwi"f%'PX̻~3g Ԯs:V[96K4R=.9]IN_lhЕPK@,ok E8>: "Y*-]PxDX!KS^P|2>j:hI "/zRHS6C}+5FgyzRqh8aIadB!/ƠɧJ]JIiY. ЧFθ0D6K5UGBJ$ ɑ Åq''ӫp`ߪm1BVJ25mjUIisBd!EV'?zە7Mu3(s|yomܒЋK7ޕP "Pi,Rr/u$ )й,M2K.t>t.;**gT6pa6R_%Pt>*`ffVד5!N  48;d C3esI*_5hxMsU?42 g&u65c>Zc#uw htL:e_]) zBk!O5q>НK`kawy i!A𯀶>9 /#7;D \"ۧDUJ,dAo?"B-_,Vk(5g.00ezZ4A=8F{:_VEr5K5B>gX3IM#G&TV߉$ҏ/SPlr>7 5kҿL3r9- jaE:g>_9U~Q~A;eye < T+"k쨓]&$vPكD(pZṽٮ"1JBD{zU XvK[Z\U8C{1'N p*xKK/P{ioX9sP w'gpxٺ/`-a@ }Tln3R6oNa V6X8؞z^ Gb?N1У {HJ| 2U@$`.ЗdGӣhj8Vt9h9"iͮJ^2&Z3uO}\Zg;휈^L͐ ܲYgϬf(3?cxUQޑeuyugjVQ(s}B̊Fq8ffY g,jUQi;)//}2fTߣCaNOI؁hv&AEsW )UKe, #C?$'yV;4r_EV(. &;'l u^UGґV0"d*ºNL؞xcM²8[Oۉ\O 5ujGDcqaۋ >@ӽ4-cX\QGnj=,ryXRPӣr[K܀)r;rO1TFXjM"qD]qaTfZeǶam^Bl$u<̊U7G &gݧ^25 (yYqZx3d0[(؛dCԙQlVJ$qVfQ.W~rMeڑT^c#4*rl0)1nۻ6=d_{P8SVǓjռ@zǁݲ\:tt|-ևClmEnd5s/xJO36]Е Ѩ; +Tw97~[VD<.]?3߇k'x oj3KCH39nH[^>33MCszc, BuvNe-Bt )$>Ljd)_I.-KQE&c7H7,!$=vO=oc[H]2=V#?%ԡ@%kOϮZ^uןW`>\ء6#[x60oX-D̦BE\*ОжsMͽ޲$U75?5axqxkXNzqUR%bw OvRWӰ}Ǵ/Φ"1BYX#9!=ї3@ L81`Zdmf5mi JW"{f#r|#<9E~ g%S At:cb+'ϽЋi?R/hRҵ駋-!Fu#ӫEh6iFXvd}r?]dMH\ݾR1và`;IMK,c $+[xŸ'zѯV-NBYeڋ,Hn3<#o|~O¤78 D #dwmoZ7DLSR…c?bURo`P,UU52 *o1Wx$|#Ah_K\PeVqMapEܳw 'и0NK{5΃Dk>Y%Nlnʟ4ĩ-2~L7q} Уlu!jͶ\!5]J icT8אK"@l2" DZpB/uk_JB,6*l ۯz1Fe+giȰ vpXcCrF~cO]: KS~ {ZNbƐoJzC8M)7imyz}h#lF!$AQ#ܽ ސ4wJKV&_]SGT ,#Ku@?}ċ2>D֞(h9rLg=M+dc=y2&z;J4r\  vej芕LQjs>$asT;wf34k͵XjҳDdR.5 ZjbxV۰nQ列lij" K%&`[MD+la M(Lgᤗ̋qigR)6@,O!MF)G"eiY^t=_ c2 <ɲR6p.(/*?Ȓg~GH ܛT5{-`bi9;0<^x(ʄkVP~H3%K Lm@A<Ѯ;;Tm.-l %"LZ%CxҺKtC޺}&}wTiI TVpPMVssg_@X78ՈY3Zo )B"vXa)^PDfO:L %}ZP_EMƒ@UsK /A94flm3 JE Ja7l)5&AF_B/最bV 0|.ݦğ8x6As |@,դ'M8r ZkmxE~ ;S5:0:;Epim wU nN*S}Ӽk%jVbphFLl;Tᬬ?Ӈ^$tPZV5iL,ܲR×+-ANU\3 E-r^5.+,(Ne姬W+}h%Uä< ,qkky^IsV0qz@UX;?5낤hZԗ|4uTگaU v(aICJ S6uLKx sGP#]_j6 W < Q`B?'vYtTg#0󜖇%92缜+D&jpz R4sX'rJ< 6E" 6XKԮ(j]wAY͵f!W1H.>l CE4~ڃ0rU_I_0-L{nj w}fig9N$,3cz ui4h B̎ LQZ(䑂Ʊ0Z>sGIˀԬ]"{ >#9>%#b!S8) R-\"C)rc9`"us|ԳWIDAu _ 3-n֋VT;bYUSG߆Co/}M:hx&D%Qz铸fU%+5[\kVߥf6aPiGG>N !o${G<"[ɮBmBԙu٫4!a*EE[-.5EC|-'s[HUF Fp̨~`2sj7B~9su1WmuVCAO8WohiW2.@t#릣< I@Df($ךt֞PHAsDoQGMfЪ"?6Y:tGy6[E&{GWLn`)tΘyΪ;R:bЌlo2#eŃed ӳXa'܅YOR&kiY\bQ ;D'4 NhLu|XsPtrDcG}MK}H N?!W3 p]f"ζaK-sObArGj]'nC.6p߿`gC ]H ]̖ UXb3qR\gHKrB|gFΐhB( u,V;U- yna LpA ;G^"%+4$@#-xZqoX{rMTZWdwx ȥ+H_&LN"m2XyAxѿxz+6Ͳ]Ju kF}_ u[d1m?PB]CkIe7dRn$>DN12EзNɭ '5s `6}Il+mͺ,Ken-%:|eo[$.^ª؄iپׅ< 9QEpq7ra [Y#[pWO_cK꜎!.u K@_` D g^'LSѮHk_Rw@!^x@MI` f$6^'Z. "AiNL}E|lD!B: ؄Zg_ZJ%1 v%d4MpJǻvPBQT י?N_*4~XSi'[>Xlt\#W!GmDLo8+-&!1ī@d#^meZ ;co/ΰVl)0@騗Æ34+BnVhE>7:# T /k,ft^FGH5ϐW;@>f_/wNRXDYIj|R'_ey|iCR-?mޞL~Bp?߷n5*ngoӒ3 μXXu*q9t/Kf )5:JM~̅0^ [t~5ʛ,qO(J \ lIrDVIo>&Uf(veijS4O?BbC"/č g;;T?iM&fH[\Ob?PrIÚS[L.U:vpפֿIv72Ft.o7lf(.bd엲ogo N5}).m@Ԣ6gp"s}q3OR{8h`nWhLex%9zYj)` У_c{P޷p̴}uQmӢgT eC0QPٜ'gm7xX25xQw%depszOb*zTײ[RNI[t~.$ =`~=>gM1t`KJACz>_`'3vfT/-Ar-j5d0YB4Ú1~=VS3<`:%`݋G!:303\p-"`r>lJ;{K`t -=E-֩ l{Y&; iδU(_}!֘>U$ϵ"l %}!e&_LZZu9?W8ĒRC5'5;/rN H:9n( :d)k]D0$W‘2k۾j]䳙&+N [TE𽀘1l(_ӥ8`,%QP13ӗr]ézo\@ twBBQɎ;:fx4pUɗ%Cg'<{BNΜ^0$I.rXqv5o}CL"Yk %H@+юv2|#x(K3s sM ʉhIW#)c(:\03F<365 BGl?3 ^tɞ("#?na>`\ l>(4};Qs1>Mb  ƀ]0A^O.kK4ɢ:r)"D 9(Hc.e)(1j<8 2,t̛]saV1XI^ F9pTb3  P$wjx$a~9h9a-z䉋3] iV&P~A95 A&1y#hXeKRpѸT#[s0bbM R_rheIU7פ ӇYS&>qU0N"T!^I7-1:h\?3D=w@N:3xE"_czREeTȗp-Ȇ3 ?ՃX6dg!psOzj0c@ㆣa_IbRlk;!.hxq!#BB㶡_@$Cd#&tZ2+k**~ü k WewG\xϱCZGx, Õ*7bNx1}@f%t7[ƍBPC*ҢWKגcz4;YS $s]jO);\z2ͫƉR{R߭1a| UQ8INfa)IWHݪ08!9wdPR#᜿$%]&NuVLLHP[Q;uf >3,cϣ)_2lwGyVSN++q`2s_Onw^JeF!iLp,!GQ1`܅3Ł-k1?|,g͖B gQD.l yR*Ÿ*?4wTj%7G$bH\3J]ϓO1xO\?CcmL.+w L.6Er4aR pC=$jf44Ñ#@$6wj^"3|KN3ƋdX9A ҟfn (#VW%̃x9楴H'~c  lEGl?5f՟}AԖswu1L{Pz$n!>pCަC2\b3UnӺL+-|`Jg$ߑZwu9'"ҟ8 ˗3YD~N78fR?TYN.b~7P?ەdG>jlZu I:SGCԘN{ܑ]0? 4,8,̕cn ƺUϼ!"@+l 9g!2R Q)x9\cnal֥ф42? Y)9pDW=RVQ O,//Qɸ ;Ϧ۞ga<__{.u`MO7O(-G k6duQ?bzUߑ5OPx>dݽڦ:$vSxNއROΐD8yeJHB?6,}%'&,-HJ{iհ%{gz{C<-V?9ZQ-K$7}buL33żbpq {9TDÀt+ 7KK. rVY!uPZy>#\ U@Id:n<gi;*Ui[,x`w=Q3k:j䝛rA lTR7dٲF]ԓʷHjD/:]R5,M2R`dīHN fhYʄRy֋BYYuQ.bu}8n*ܤ1r-Z :wc"0ciSBJ,h=j|}9AcUGCLAɣM?c'7gf).~O61֪[V%GqLٓ0i}~f:CLzQ^爷d{n^oh5]Wo>B4`%|DC[*Q4$gv9um >sCfpaEk8fPH >b|+F %,sH}zKs!aj5U6:,>s.xh!9~ւ #R}ܒцE}Q P3;f[}/-ڹ޽[9̝V>bF!ܟ=mO@t%J}X7 f$ jڽ ?'@C/sCԭM*ؐAcՃ;*Fdx+4P! j]qL6oyp( a)r~5Гed7w(|ۣCN S?}(9VJrn=݆`Y}:ɇMd1pcEsm䂍--s].3 %nmt[+Hu'xwF1tYt TŲ9E WRj,&XKh=xzv׿.oSm8W,]󜅕]p-3}7k:זl(=ӝQ#0CFVeyNҀu: GԮșT^WGwkSW&[qFN_+ xYcxs^\TP~]Evn%q8}zQ.+݇Ǧ~Ҿy k,RúfQ}Z\0^؊w[.l1[=4 zORKQN*rCZq=[1fQYMR~^^Xå>fj!Enw241>Gh8B\|| $TbV EĂ)=Z18Beg?XJJ}~Oջum`w0# P-AXU;&ǥ6T^6Kuy礀ç#+?V;(֮/.K= 运asDsfqe@o΢HbNjASVgӱJŎMN̅UiSXK UWқª9kin֘`k^l+LZڱo"$]M3[A9WbxN?T aj: Mt&L`2oRZ956Eˋ0;G3#O'q/ nKij\:<%BH =]`lCPʊ:>`thOCzjzI^ GϩȻ2IFҤTKȾz]c4"M?AuNҞݯ2ظZN' k6hK5f^L}zdn?Y+} j.|{NB>$3udIuSV\f&Mz/4/)#@}"MI_PDH[ ԗ+ꝐT2+:SlO!ZmS%Qp U_|n9t1RdzɫA /ͥ0)# L̍5 ^' 99(rR&%"[#>^5f,sr[8o _4+KT*`#yr<: `{uxbL0(8"L<Pԟ a+B{1ʋr^>TGiSP ,wqڱ&Sz#EDCV{gb~S=`-R} iDMI4.X3bn~p\Y;3W1)nCkk9u%!n?}sUyoA.ZGe=~#`f!~g|qyDO,:?!PGP/KSr7Oq=OxZ+s/5B8x2gdHvs's Y !O6'uVΌ~TMa.Q-àD/$>, %֕p>l4)Z]ϊT:tC"3(YwN.H_38$fr2[}eBbJݑ\"7%y.͵q"Np/,'Sat^sSm J#ű쒨Y GZ1?PPy1Lmr.$bNnN~ng.(6=Hm3b*am$xǟAo}CRpp*7!,g*| b{":2v`eX[ #z4irP{roiw4GC7ytrp5 {¢]tq70kίGHLYGCԇ?[N 7(˱;v3Y]=+jLݪp,N\ftwi)6:<Ϣژ(l$cEq9*a.Qډb?mwk}ןjk)7iIK%,%Xx'y3w̕A-`) Rwv#q)q"O hXOgzԭޒC ٿ 翭?ETt+ۜxx\_KrDU[H* WX%XF؞Y%P5QA=]|!jX?b⠷q')VXڲm A":#Uc#XRܸd"؃FGߞ׺`(g.~,mJ?fz)XxQMܺ8ͿԲ|5Fy%!fiK->жfx7V~EZ^\AMlLZx$2s9Ψ2Ug`_J&D(}Clio i˻I (v4wZj+^( ;0F[0+歿ZtYiᑦc$,"T jԸ+{eKrk@mArp2am 3QVBӔ+\| 5TMgrk*ȘoͻO"GŎ%#~Ơ zw"8Q'@Q!غ$A[jllDU0rRV.(b.t'1ءhy"d}O~Q09^H|tˑQxrZ4PBeޭ@7AmCLu:t*^nhF?}N&kGN5mjrcݤ'J!VDV פp=|@ hJd*?J- ̵'PWHD&d]Ѣ-rFq٫eKsax u\l+9%sIc8?J!GvuV6#ynYm*MGE#$-QxZ. Hf$\B7m{Fx>P-5"Lo*Wq'|{X.eQRIwOq *(k(Ű_*N3Bр !b1ZΜ1GFK,bdBҠvfU|[EJ:;殩LifwP,W6TNbo0v=KDSPU~DP\] A3)GѪXrr'?L,&c_x6""ug5lj.MIBGE+zs4tI(3_KI[hGߏ*vj([]@({[T@G/[Ux[hng.@~@c(p& A%(<ＤvIPAB)}dB~pRtB˟+B VH>i'9f>d4mmkU\3PPc#o?v;$ oAqCiЙ{n㟻D*;'w+GT{"ٌ&ܒzSbޯkWohB~aeӢ_nم 9arEw C2, ]6/ 4ZSPV]kSX(@vԃCec/kɎ>|3mT*<ګ[>7 IYF< -Y;W}XyЉ@ ~JJ m^oʽc7PU& rc]j ,҉3[KD̫9"fQU9{UNw k0eR-v=4M=$wY#>A;yo^{`VUsFޱJ3*hi*Yi_\h3Mg ލPѼ):RNVd%|qr:Fkc&rgډ|'R >&]5425 eoR%?1-뢒un#X| rodJΉ1Ppni?yzQW ^Uպܣ^eٶU:J=Ev{-h jPcA^/VҕKwPɝD)^l9b$H'.'q=cG,8nuNމ* j}rE6j#Ơp%ų ɖ&)ſ"b*tA37n+BBCɝ1uX qoh $*ݛj.dkKwM9t$KmmbvvkuW+!!qw%f` V |BF&{=|:ֱYs ;4-Szw}~wG2B0@'er%*_E|n>cY0W0kۑڷ.%-G':q5c>=~t֬\r*_?k~ ȼ师J3'NeV7@^2KgnE10};әjm 9lۂHd qd9Qx/O{ =Ur79I _!ZBu- =)`{m:ˁ-'_M]wO;a<2z?߄-ŜHXu*Qk?ɸx[MS0)acS)ژv_9¾a H7bk2]K9 $]Ade?o eLN HH{9xIg#eXy-cjsqv!?NsM犌{FyR֜@ml#F bɼggΙVS^LH{=Jq.H(K#K`+T*@T$*2z *QiLakڣ2,]S;-6+3knYsBʎ^>՜$~C&QrExjXkPYƂ`^!ާ`ey\gO2#_^'PnfarGZW 12ĖZ ]$U7^ʬ-)O )?3(_qS݇o_'7`$#5ѥ,s:pyɽʼnO՛c~#F;6Ud*~|rYȍ'L!W޵x-8= '8LǨ2I9ָJ | ( |P[v)c´9K@Vj`}#iNN$*$~a4Y߻tkof'[5o_>eIME vbuxƣn,(%zB*z:+EÆA>˰rUwIy/S'mq E%X)e`8* ?EI5/2QHI6ƒ<'7(U$\p<xP}5꥞ti. qiQ, f?WU.o/aKUG@P,VSax'\%vDH9Zk?AyVŠ]* r=]VYgNGX hNooipͥ?lNǭcY+FB(2B7LqwٳcEz~dfOOGc.[w5<7X (gF> un,fy4βsٶ^EqM&=Z" :M4 f{F10jHr7IXR@Uv],p*xujWu}j\RhΥ)0cFfL;âa "]u|]p`ޣ $Vn"^R{Nj̆Jn;Ш|rjrV9VkI~b# \f*;(:'hrnֽ6s&Om&)~ԥU[zvfhf.PgYQ f.cΤ7. (qqd͛IViT,W?u-(p)2gO!vꔳ̙gԦL3ot-$50!3n-d'\>'US-:ptl8iC,n|!bHA瓝kknkߪ>%"X7a^h1cZBm7i iuVlSvw|79_F0)Chw$(Z[pʶ5@} R* )OJyc_amhq܄Lw즟U`ѡP⦸:bg$:K;vw^u1V+0-㜢x\;ɴ [VLʹ3p?$2•cp|XIyWVo#Pe] KkM.}eQ-Cå2G809)wr۴-AVcO(fo&~%Cu5>U(\1yRT#KJ>} Kvg(ljhuS$_Q 7N/m$ڻ f^qa:amq. ,.H7駖n#)ֿd'-6ge֩g Ѩ|Xe^x=]'6AғYF\W&D)NQM_j: 1CEivr)K,LEPeK%[$=xJ1g͝m~y9Wϐs%)4 [,\,B0paPt.oWPwJll X!.7q{29?hjzŖ4[л*u_ǀ3:WaĦd`W!]4 G(jDfjpddpm^S n<0BA*d\>@kfk6%qga 2#@Ohlf1DL\3R|4O@wl= ݤF2':#eyX篁gbq YZ